Property Summary

NCBI Gene PubMed Count 29
PubMed Score 42.51
PubTator Score 36.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Endometriosis 535
Disease Target Count P-value
dermatomyositis 966 1.4e-04
psoriasis 6685 1.8e-04
cystic fibrosis 1670 8.6e-04
diabetes mellitus 1663 1.2e-03
osteosarcoma 7933 1.9e-03
Disease Target Count Z-score Confidence
Familial retinoblastoma 2 4.188 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.800 1.8e-04
osteosarcoma -1.070 1.9e-03
cystic fibrosis 1.051 8.6e-04
diabetes mellitus -1.100 1.2e-03
dermatomyositis 1.400 1.4e-04

Gene RIF (6)

PMID Text
24858910 retinoblastoma RB1 -/- cells cannot survive in the absence of MED4, both in vitro and in orthotopic xenograft models in vivo, therefore identifying MED4 as a survival gene in retinoblastoma.
19411183 Our findings suggest that Vitamin D Receptor polymorphisms may be associated with nasal carriage of S. aureus in individuals with type 1 diabetes.
18976975 Knockdown of MED4 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 4 (MED4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED4 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 4 (MED4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLI      1 - 70
HRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK     71 - 140
GAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG    141 - 210
RLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD              211 - 270
//

Text Mined References (34)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24858910 2014 The survival gene MED4 explains low penetrance retinoblastoma in patients with large RB1 deletion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
21505449 2011 Genotype-phenotype correlations in patients with retinoblastoma and interstitial 13q deletions.
21293490 2011 Mediator is a transducer of amyloid-precursor-protein-dependent nuclear signalling.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19911042 2009 Gene dosage, expression, and ontology analysis identifies driver genes in the carcinogenesis and chemoradioresistance of cervical cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17438371 2007 Detection and identification of transcription factors as interaction partners of alien in vivo.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15690163 2005 The mediator of RNA polymerase II.
15680972 2005 The mammalian Mediator complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11867769 2002 The TRAP/Mediator coactivator complex interacts directly with estrogen receptors alpha and beta through the TRAP220 subunit and directly enhances estrogen receptor function in vitro.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10882111 2000 The USA-derived transcriptional coactivator PC2 is a submodule of TRAP/SMCC and acts synergistically with other PCs.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
10235266 1999 Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.