Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.11
PubTator Score 4.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q9Y3C7 B2R4L9
Symbols Soh1
CGI-125
3110004H13Rik

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP      1 - 70
QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK              71 - 131
//

Text Mined References (19)

PMID Year Title