Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.37
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.729 3.5e-04
group 3 medulloblastoma 1.900 2.8e-04
primitive neuroectodermal tumor 1.100 3.7e-02
ovarian cancer 1.500 1.3e-03
Breast cancer 1.300 5.4e-04

 GWAS Trait (1)

Gene RIF (4)

PMID Text
25100719 SiRNA knockdown of d MED30 shows a modest inhibition in HIV-1 Tat-mediated transcription levels as compared to control
25100719 Knockdown of mediator complex subunit 30 (MED30) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
20493979 analysis of a novel transcript of MED30, termed MED30 short (MED30s) generated by alternative splicing
11909976 Requirement of TRAP/mediator for both activator-independent and activator-dependent transcription in conjunction with TFIID-associated TAF(II)s.

AA Sequence

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGT      1 - 70
YQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERR     71 - 140
EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN                                    141 - 178
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22446961 2012 Two new susceptibility loci for Kawasaki disease identified through genome-wide association analysis.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20493979 2010 Mediator subunits: gene expression pattern, a novel transcript identification and nuclear localization in human endothelial progenitor cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
16595664 2006 Human Mediator enhances basal transcription by facilitating recruitment of transcription factor IIB during preinitiation complex assembly.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218053 2002 A coregulatory role for the TRAP-mediator complex in androgen receptor-mediated gene expression.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
11909976 2002 Requirement of TRAP/mediator for both activator-independent and activator-dependent transcription in conjunction with TFIID-associated TAF(II)s.
11867769 2002 The TRAP/Mediator coactivator complex interacts directly with estrogen receptors alpha and beta through the TRAP220 subunit and directly enhances estrogen receptor function in vitro.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
10235266 1999 Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.
10198638 1999 Identity between TRAP and SMCC complexes indicates novel pathways for the function of nuclear receptors and diverse mammalian activators.