Property Summary

NCBI Gene PubMed Count 25
PubMed Score 171.05
PubTator Score 81.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.007 3.1e-03
Multiple myeloma 1.062 8.0e-03
osteosarcoma -2.265 1.2e-09
group 3 medulloblastoma 2.000 9.1e-05
glioblastoma 1.400 1.9e-02
atypical teratoid / rhabdoid tumor 1.400 5.7e-07
medulloblastoma, large-cell 1.400 8.3e-05
acute quadriplegic myopathy 1.119 9.5e-05
lung cancer 1.400 4.9e-04
adult high grade glioma -1.200 1.3e-03
Pick disease 1.100 2.3e-04
ovarian cancer 1.300 4.7e-03

Gene RIF (15)

PMID Text
26660958 All trans-retinoic acid can reverse the suppressive effect of MED28 on HBP1 and E-cadherin and inactivate the Wnt/beta-catenin pathway in colorectal cancer, suggesting a protective effect of ATRA against colorectal cancer.
25100719 Knockdown of mediator complex subunit 28 (MED28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
23950709 This paper describes a link between Med23 and IFN-lambda3, provides evidence for the crucial role of IFN-lambda in HSV-1 immune control.
22495818 These data indicate that MED28 regulates cellular migration in a MEK1-dependent manner in human breast cancer cells, reinforcing the important cellular roles of MED28.
20584319 High MED28 is associated with breast cancer.
18976975 Knockdown of MED28 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 28 (MED28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED28 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 28 (MED28) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17848560 Study reports that down-regulation of human Med28 expression in NIH3T3 cells results in a significant induction of several genes associated with smooth muscle cell (SMC)differentiation; conversely, overexpression of MED28 represses SMC gene expression.
17568184 EG-1 has a role in breast tumor growth
16964398 EG-1 may be involved in signaling pathways including c-Src activation.
16899217 May serve as a multi-faceted adaptor/scaffold to relay cellular signaling to the cytoskeleton and from the cytoskeleton to the nucleus.
16024617 EG-1 is a positive stimulator of cellular proliferation, and may possibly be involved in signaling pathways involving Src and MAPK activation.
15467741 demonstrate an interaction between Grb2 and magicin. In addition, merlin is capable of forming a ternary complex with magicin and Grb2

AA Sequence

MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQ      1 - 70
EEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQ     71 - 140
QVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT                                    141 - 178
//

Text Mined References (27)

PMID Year Title
26660958 2016 All Trans-Retinoic Acid Mediates MED28/HMG Box-Containing Protein 1 (HBP1)/?-Catenin Signaling in Human Colorectal Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23950709 2013 A systematic analysis of host factors reveals a Med23-interferon-? regulatory axis against herpes simplex virus type 1 replication.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22495818 2012 MED28 regulates MEK1-dependent cellular migration in human breast cancer cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20584319 2010 Elevated MED28 expression predicts poor outcome in women with breast cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17848560 2007 Mediator subunit MED28 (Magicin) is a repressor of smooth muscle cell differentiation.
17568184 2007 Targeted inhibition of EG-1 blocks breast tumor growth.
16964398 2006 EG-1 interacts with c-Src and activates its signaling pathway.
16899217 2006 Magicin associates with the Src-family kinases and is phosphorylated upon CD3 stimulation.
16763564 2006 Roles for APIS and the 20S proteasome in adenovirus E1A-dependent transcription.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16024617 2005 The novel gene EG-1 stimulates cellular proliferation.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467741 2004 Magicin, a novel cytoskeletal protein associates with the NF2 tumor suppressor merlin and Grb2.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11779215 2002 Identification of a novel endothelial-derived gene EG-1.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10656681 2000 Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins.