Property Summary

NCBI Gene PubMed Count 13
PubMed Score 28.96
PubTator Score 4.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.6e-04
osteosarcoma 7950 2.0e-03
Disease Target Count Z-score Confidence
medulloblastoma 720 4.227 2.1
Cerebellar medulloblastoma 4 3.841 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.022 2.0e-03
ovarian cancer 1.200 4.6e-04

Gene RIF (5)

AA Sequence

MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNEL      1 - 70
ERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQM     71 - 140
GVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFID    141 - 210
RTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAP    211 - 280
CQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ                                           281 - 311
//

Text Mined References (19)

PMID Year Title