Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.41
PubTator Score 10.67

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 3.3e-03


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.174 3.3e-03

Protein-protein Interaction (11)

Gene RIF (8)

25575120 the MED26-NTD functions as a molecular switch in the exchange of TBP-associated factor 7 (TAF7) for LEC to facilitate the transition from initiation to elongation during transcription of a subset of snRNA genes
25100719 Knockdown of MED26 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
25100719 Knockdown of mediator complex subunit 26 (MED26) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
21729782 MED26 can function as a molecular switch that interacts first with TFIID in the Pol II initiation complex and then exchanges TFIID for complexes containing ELL/EAF and P-TEFb to facilitate transition of Pol II into the elongation stage of transcription.
19049968 findings identify MED19/MED26 as a probable composite REST interface in Mediator and further clarify the mechanistic basis by which Mediator facilitates REST-imposed epigenetic restrictions on neuronal gene expression
18976975 Knockdown of MED26 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 26 (MED26) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12050112 Human CRSP interacts with RNA polymerase II CTD and adopts a specific CTD-bound conformation

AA Sequence

PGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD                                  561 - 600

Text Mined References (17)

PMID Year Title
25575120 2015 MED26 regulates the transcription of snRNA genes through the recruitment of little elongation complex.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
20111005 2010 Crosstalk between C/EBPbeta phosphorylation, arginine methylation, and SWI/SNF/Mediator implies an indexing transcription factor code.
19049968 2009 MED19 and MED26 are synergistic functional targets of the RE1 silencing transcription factor in epigenetic silencing of neuronal gene expression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12050112 2002 Human CRSP interacts with RNA polymerase II CTD and adopts a specific CTD-bound conformation.
10811649 2000 Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
9989412 1999 The transcriptional cofactor complex CRSP is required for activity of the enhancer-binding protein Sp1.