Property Summary

NCBI Gene PubMed Count 29
PubMed Score 14.43
PubTator Score 7.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
hereditary spastic paraplegia -1.060 5.8e-03
medulloblastoma, large-cell -1.100 7.1e-06
ovarian cancer -1.700 1.1e-03

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID      1 - 70
VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS     71 - 140
LPDS                                                                      141 - 144
//

Text Mined References (33)

PMID Year Title