Property Summary

NCBI Gene PubMed Count 28
PubMed Score 14.83
PubTator Score 7.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 7.1e-06
hereditary spastic paraplegia -1.060 5.8e-03
ovarian cancer 1.800 4.0e-03

Synonym

Accession Q13503 B2R4I3 Q6IB05 Q92811
Symbols SRB7
SURB7
hSrb7

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (4)

PMID Text
25100719 Knockdown of mediator complex subunit 21 (MED21) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
20520624 Blocking MED1/MED21 expression caused hyperproliferation of keratinocytes
15710619 Co-expressed yeast MED21 and MED7 in E. coli to determine structure.
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes SRB7, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAALIARTAKDID      1 - 70
VLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS     71 - 140
LPDS                                                                      141 - 144
//

Text Mined References (32)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
20520624 2010 The transcriptional coactivator DRIP/mediator complex is involved in vitamin D receptor function and regulates keratinocyte proliferation and differentiation.
19096501 2008 Malleable machines in transcription regulation: the mediator complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15710619 2005 A conserved mediator hinge revealed in the structure of the MED7.MED21 (Med7.Srb7) heterodimer.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15249124 2004 hSrb7, an essential human Mediator component, acts as a coactivator for the thyroid hormone receptor.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12037571 2002 Transcription coactivator TRAP220 is required for PPAR gamma 2-stimulated adipogenesis.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11441538 1999 Genomics of the human genes encoding four TAFII subunits of TFIID, the three subunits of TFIIA, as well as CDK8 and SURB7.
11278802 2001 Three RNA polymerase II carboxyl-terminal domain kinases display distinct substrate preferences.
10024883 1999 A novel human SRB/MED-containing cofactor complex, SMCC, involved in transcription regulation.
9933582 1999 The human homologue of Drosophila TRF-proximal protein is associated with an RNA polymerase II-SRB complex.
9872325 1998 Upregulation of cyclin T1/CDK9 complexes during T cell activation.
9734358 1998 NAT, a human complex containing Srb polypeptides that functions as a negative regulator of activated transcription.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
9660976 1998 Transcription activation via enhanced preinitiation complex assembly in a human cell-free system lacking TAFIIs.
9443979 1998 Factors associated with the mammalian RNA polymerase II holoenzyme.
9305922 1997 Interaction of elongation factors TFIIS and elongin A with a human RNA polymerase II holoenzyme capable of promoter-specific initiation and responsive to transcriptional activators.
9159119 1997 BRCA1 is a component of the RNA polymerase II holoenzyme.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
8609996 1996 A human RNA polymerase II complex associated with SRB and DNA-repair proteins.
8598913 1996 A mammalian SRB protein associated with an RNA polymerase II holoenzyme.
2320128 1990 Sequencing and expression of complementary DNA for the general transcription factor BTF3.