Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.70
PubTator Score 25.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.133 9.4e-04
urothelial carcinoma 1.100 1.4e-02
malignant mesothelioma 1.400 8.2e-07
osteosarcoma -1.477 5.3e-05
group 3 medulloblastoma 1.800 6.1e-06
astrocytoma 1.200 1.3e-02
glioblastoma 1.400 1.4e-02
primitive neuroectodermal tumor 1.300 1.8e-03
lung cancer 1.600 3.3e-03
ovarian cancer 2.000 4.1e-04

Gene RIF (6)

PMID Text
25482373 These findings suggest that hMED17 may play essential roles in switching between transcription and nucleotide excision repair.
25437875 TRAP80 is a selective regulator of hepatic lipogenesis and is required for LXR-dependent SREBP-1c activation.
21326907 Studies indicate that the activation domain of p53 (p53AD) binds directly to the MED17 subunit of Mediator, whereas the p53 C-terminal domain (p53CTD) binds the MED1 subunit.
20950787 the p. L371P mutation in MED17 is a founder mutation in the Caucasus Jewish community and that homozygosity for this mutation is associated with infantile cerebral and cerebellar atrophy with poor myelination.
18976975 Knockdown of MED17 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 17 (MED17) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEAAGTEGDAQEW      1 - 70
PGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVRDKKFMTLDPVSQDALPPKQN     71 - 140
PQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYR    141 - 210
SAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRP    211 - 280
LPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSN    281 - 350
DKKSQKFATEKQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINS    351 - 420
LQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKS    421 - 490
IQLQLNIGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPI    491 - 560
ESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKM    561 - 630
EGRNFVYKMELLMSALSPCLL                                                     631 - 651
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25482373 2015 Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.
25437875 2015 Hepatic TRAP80 selectively regulates lipogenic activity of liver X receptor.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21326907 Mediator and post-recruitment regulation of RNA polymerase II.
21269460 2011 Initial characterization of the human central proteome.
20950787 2010 Infantile cerebral and cerebellar atrophy is associated with a mutation in the MED17 subunit of the transcription preinitiation mediator complex.
19946888 2010 Defining the membrane proteome of NK cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16595664 2006 Human Mediator enhances basal transcription by facilitating recruitment of transcription factor IIB during preinitiation complex assembly.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16109376 2005 The bromodomain protein Brd4 is a positive regulatory component of P-TEFb and stimulates RNA polymerase II-dependent transcription.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12509459 2003 Role of metazoan mediator proteins in interferon-responsive transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218053 2002 A coregulatory role for the TRAP-mediator complex in androgen receptor-mediated gene expression.
12037571 2002 Transcription coactivator TRAP220 is required for PPAR gamma 2-stimulated adipogenesis.
11867769 2002 The TRAP/Mediator coactivator complex interacts directly with estrogen receptors alpha and beta through the TRAP220 subunit and directly enhances estrogen receptor function in vitro.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
10235266 1999 Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.
10198638 1999 Identity between TRAP and SMCC complexes indicates novel pathways for the function of nuclear receptors and diverse mammalian activators.
9989412 1999 The transcriptional cofactor complex CRSP is required for activity of the enhancer-binding protein Sp1.
8710870 1996 Ligand induction of a transcriptionally active thyroid hormone receptor coactivator complex.