Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.66
PubTator Score 8.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Endometriosis 535
Disease Target Count P-value
ovarian cancer 8491 1.5e-08
psoriasis 6685 2.7e-04
hereditary spastic paraplegia 313 6.3e-04
astrocytoma 1493 3.2e-03
Rheumatoid Arthritis 1170 3.5e-03
dermatomyositis 966 1.0e-02
osteosarcoma 7933 3.3e-02
spina bifida 1064 4.9e-02
Disease Target Count Z-score Confidence
Bulimia nervosa 15 4.006 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.300 3.5e-03
psoriasis 1.400 2.7e-04
osteosarcoma -1.073 3.3e-02
astrocytoma 1.200 3.2e-03
hereditary spastic paraplegia 1.579 6.3e-04
spina bifida -1.128 4.9e-02
ovarian cancer 2.900 1.5e-08
dermatomyositis 1.100 1.0e-02

 MGI Phenotype (1)

Protein-protein Interaction (2)

AA Sequence

MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHP      1 - 70
WDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSLVEGDPIVALSWLHNG     71 - 140
VKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLR    141 - 210
GRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAI    211 - 280
THLKFLARDMSEQVLLCASSQTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDR    281 - 350
VSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMK    351 - 420
RPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWD    421 - 490
ILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTL    491 - 560
KSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLA    561 - 630
SLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICC    631 - 700
RDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGL    701 - 770
ARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLAVEGRGPDACVT    771 - 840
SRASEEAPAFVQLGPQSTHHSPRTPRSLDHLHPEDRP                                     841 - 877
//

Text Mined References (13)

PMID Year Title
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
19946888 2010 Defining the membrane proteome of NK cells.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14638676 2004 A mammalian mediator subunit that shares properties with Saccharomyces cerevisiae mediator subunit Cse2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218053 2002 A coregulatory role for the TRAP-mediator complex in androgen receptor-mediated gene expression.
11867769 2002 The TRAP/Mediator coactivator complex interacts directly with estrogen receptors alpha and beta through the TRAP220 subunit and directly enhances estrogen receptor function in vitro.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10235266 1999 Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.
10198638 1999 Identity between TRAP and SMCC complexes indicates novel pathways for the function of nuclear receptors and diverse mammalian activators.
8710870 1996 Ligand induction of a transcriptionally active thyroid hormone receptor coactivator complex.