Property Summary

NCBI Gene PubMed Count 30
PubMed Score 37.75
PubTator Score 23.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.200 1.4e-03
ovarian cancer 1.200 4.9e-04

Protein-protein Interaction (5)

Gene RIF (15)

PMID Text
26457685 MED15 as a potential biomarker for head and neck squamous cell carcinoma
26377566 MED15 is differentially expressed in tumor-free testis and testicular germ cell tumors
25791637 MED15 overexpression is a clonal event during head and neck squamous cell carcinoma progression.
24374838 these findings implicate MED15 in CRPC, and as MED15 is evolutionary conserved, it is likely to emerge as a lethal phenotype in other therapeutic-resistant diseases, and not restricted to our disease model.
22916034 MED15 and PUM1 proteins with coiled-coil domains are potent enhancers of polyQ-mediated ataxin-1 protein misfolding and proteotoxicity in vitro and in vivo.
20025940 The data identify PC2 as a novel PLAGL2-binding protein and important mediator of PLAGL2 transactivation.
18854154 Knockdown of mediator complex subunit 15 (MED15) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16904669 results suggest that TRIM11, with the ubiquitin-proteasome pathway, regulates ARC105 function in TGFbeta signaling
16799563 SREBPs use the evolutionarily conserved ARC105 (also called MED15) subunit to activate target genes
15455391 TIG1 gene Silencing by promoter hypermethylation is associated with nasopharyngeal carcinoma
15318033 Observational study of gene-disease association. (HuGE Navigator)
15318033 Limited role of exon 7 PCQAP polymorphisms in the pathogenesis of schizophrenia.
14691453 Methylation of TIG1 in prostatic neoplasms correlates with methylation of the retinoic acid receptor beta gene.
12497610 Observational study of gene-disease association. (HuGE Navigator)
10235267 The protein encoded by this gene was identified as ARC105, a 105kDa component of the Activator-Recruited Cofactor (ARC) that is involved in mediating gene activation by several classes of transcriptional regulators.

AA Sequence

MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIH      1 - 70
NKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTSGMAPHS     71 - 140
MAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQL    141 - 210
QQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQP    211 - 280
PPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRA    281 - 350
PMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQMITEALAQGGMHIRARFPPTTAVSAIPSSSIPLGRQ    351 - 420
PMAQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQ    421 - 490
SPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRK    491 - 560
KDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIR    561 - 630
SPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSN    631 - 700
NGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVT    701 - 770
ALLNTWAQSVHQACLSAA                                                        771 - 788
//

Text Mined References (37)

PMID Year Title
26457685 2015 MED15: a potential biomarker for head and neck squamous cell carcinoma?
26377566 2015 Differential expression of Mediator complex subunit MED15 in testicular germ cell tumors.
25791637 2015 Clinical and molecular implications of MED15 in head and neck squamous cell carcinoma.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24374838 2014 MED15, encoding a subunit of the mediator complex, is overexpressed at high frequency in castration-resistant prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916034 2012 Identification of human proteins that modify misfolding and proteotoxicity of pathogenic ataxin-1.
21269460 2011 Initial characterization of the human central proteome.
20025940 2010 Modulation of PLAGL2 transactivation by positive cofactor 2 (PC2), a component of the ARC/Mediator complex.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18568018 2008 TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
16904669 2006 TRIM11 binds to and destabilizes a key component of the activator-mediated cofactor complex (ARC105) through the ubiquitin-proteasome system.
16799563 2006 An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16630888 2006 Genome-wide location of the coactivator mediator: Binding without activation and transient Cdk8 interaction on DNA.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15455391 2005 Silencing of the retinoid response gene TIG1 by promoter hypermethylation in nasopharyngeal carcinoma.
15318033 2004 An association study of PCQAP polymorphisms and schizophrenia.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14983011 2004 The activator-recruited cofactor/Mediator coactivator subunit ARC92 is a functionally important target of the VP16 transcriptional activator.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691453 2004 Methylation of the retinoid response gene TIG1 in prostate cancer correlates with methylation of the retinoic acid receptor beta gene.
12497610 2003 Association study between CAG trinucleotide repeats in the PCQAP gene (PC2 glutamine/Q-rich-associated protein) and schizophrenia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167862 2002 A component of the ARC/Mediator complex required for TGF beta/Nodal signalling.
11414760 2001 Isolation and characterization of a novel gene from the DiGeorge chromosomal region that encodes for a mediator subunit.
11024300 2000 A novel glutamine-rich putative transcriptional adaptor protein (TIG-1), preferentially expressed in placental and bone-marrow tissues.
10235267 1999 Composite co-activator ARC mediates chromatin-directed transcriptional activation.
9225980 1997 cDNAs with long CAG trinucleotide repeats from human brain.