Property Summary

NCBI Gene PubMed Count 34
PubMed Score 43.79
PubTator Score 18.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.800 5.6e-06
astrocytic glioma -1.100 1.8e-02
Astrocytoma, Pilocytic 1.200 6.3e-05
atypical teratoid / rhabdoid tumor 1.500 6.7e-08
ependymoma 1.100 1.6e-02
glioblastoma 1.200 1.6e-07
group 3 medulloblastoma 1.300 3.2e-03
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
intraductal papillary-mucinous carcinoma... 1.200 2.7e-03
intraductal papillary-mucinous neoplasm ... 1.600 5.2e-03
lung adenocarcinoma 1.003 7.0e-08
medulloblastoma, large-cell 1.100 8.4e-05
osteosarcoma 1.224 2.8e-03
ovarian cancer -2.000 2.2e-07
primitive neuroectodermal tumor 1.200 7.6e-04
psoriasis 1.200 7.0e-04
subependymal giant cell astrocytoma -1.124 3.2e-02
tuberculosis -1.700 2.2e-09

Synonym

Accession O60244 Q4KMR7 Q9UNB3
Symbols CSRP
RGR1
CRSP2
EXLM1
CXorf4
CRSP150
DRIP150
TRAP170

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (13)

AA Sequence

MAPVQLENHQLVPPGGGGGGSGGPPSAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLT      1 - 70
DLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLA     71 - 140
RDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPP    141 - 210
QLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQS    211 - 280
RLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTG    281 - 350
TASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAIL    351 - 420
RGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRII    421 - 490
PWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNK    491 - 560
PTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVESKKTKR    561 - 630
AGEMCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGITEETQKA    631 - 700
LDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDW    701 - 770
NSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGP    771 - 840
NSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQS    841 - 910
STHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNE    911 - 980
DDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAA    981 - 1050
SSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSP   1051 - 1120
AARMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSP   1121 - 1190
TPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQT   1191 - 1260
LQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQAT   1261 - 1330
QLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQAD   1331 - 1400
IPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP                   1401 - 1454
//

Text Mined References (46)

PMID Year Title