Property Summary

NCBI Gene PubMed Count 8
PubMed Score 24.04
PubTator Score 17.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.300 3.0e-02
ovarian cancer 1.200 6.2e-05

Synonym

Accession Q9BTT4 C6G491
Symbols L6
NUT2
TRG20

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEY      1 - 70
IDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS          71 - 135
//

Text Mined References (13)

PMID Year Title
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
21269460 2011 Initial characterization of the human central proteome.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15657623 2005 Determination of the 'critical region' for cat-like cry of Cri-du-chat syndrome and analysis of candidate genes by quantitative PCR.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14576168 2003 A mammalian homolog of Drosophila melanogaster transcriptional coactivator intersex is a subunit of the mammalian Mediator complex.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10993082 2000 TFIIH is negatively regulated by cdk8-containing mediator complexes.
10024883 1999 A novel human SRB/MED-containing cofactor complex, SMCC, involved in transcription regulation.