Property Summary

NCBI Gene PubMed Count 104
PubMed Score 83.28
PubTator Score 139.13

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.192 1.1e-07
astrocytoma 1.300 5.4e-03
atypical teratoid / rhabdoid tumor 1.500 2.2e-07
glioblastoma 1.100 7.8e-06
group 3 medulloblastoma 1.800 3.6e-04
lung cancer 1.200 7.8e-04
malignant mesothelioma 1.900 1.1e-06
medulloblastoma, large-cell 1.800 6.4e-05
non primary Sjogren syndrome sicca -1.200 2.0e-02
osteosarcoma 1.072 1.2e-03
ovarian cancer 1.200 3.5e-04
Pick disease 1.100 4.4e-06
pituitary cancer 1.100 2.4e-05
primitive neuroectodermal tumor 1.600 8.7e-07
Rheumatoid arthritis 1.800 4.8e-05

PDB (35)

Gene RIF (59)

AA Sequence

DQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN                                1541 - 1581

Text Mined References (123)

PMID Year Title