Property Summary

NCBI Gene PubMed Count 124
PubMed Score 115.20
PubTator Score 231.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 5.016 2.5
Gamma chain deficiency 7 3.096 1.5

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -2.700 1.3e-06
posterior fossa group A ependymoma 5.000 3.3e-18
Barrett's esophagus 1.200 2.0e-02
esophageal adenocarcinoma 1.800 1.8e-02
psoriasis 1.200 8.3e-04
osteosarcoma 2.231 1.1e-03
glioblastoma 1.300 3.3e-03
cystic fibrosis 1.878 3.5e-06
medulloblastoma, large-cell -1.200 3.7e-02
primitive neuroectodermal tumor 1.100 4.1e-02
adrenocortical carcinoma 1.432 8.4e-05
intraductal papillary-mucinous adenoma (... 2.900 5.5e-05
intraductal papillary-mucinous carcinoma... 1.500 9.4e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.1e-02
lung cancer -3.500 5.6e-06
interstitial cystitis -2.000 9.6e-05
lung adenocarcinoma -1.300 1.5e-09
pediatric high grade glioma 1.100 9.9e-03
Breast cancer 1.400 3.3e-02
lung carcinoma -1.300 1.2e-25
spina bifida -1.073 3.0e-02
Pick disease 1.200 2.8e-02
ductal carcinoma in situ -1.400 1.5e-03
invasive ductal carcinoma -2.000 1.0e-03
acute myeloid leukemia -2.300 4.2e-02
ovarian cancer 5.500 1.5e-12
chronic rhinosinusitis -1.046 5.3e-03
dermatomyositis 1.100 7.8e-03
facioscapulohumeral dystrophy -1.200 2.1e-02

Gene RIF (96)

PMID Text
26935937 Isochromosome 3q, especially MECOM abnormality, could play a key role in Persistent polyclonal binucleated B-cell lymphocytosis.
26815134 involvement of MECOM in patients with acute myeloid leukemia and myelodysplastic syndrome with various 3q abnormalities
26729571 EVI1 overexpression has been revealed as an important independent adverse prognostic marker in adult acute myeloid leukemia and defines distinct risk categories in 11q23-rearranged AML.
26674644 RUNX1-Evi-1 may promote proliferation and apoptosis resistance of primitive hematopoietic cell, and inhibit the differentiation of myeloid cells with the synergy of different pathways and factors.
26581901 Mutations in MECOM cause radioulnar synostosis with amegakaryocytic thrombocytopenia.
26554871 MECOM deletion is associated with congenital thrombocytopenia.
26467814 A RT-qPCR assay was used to quantify EVI1 expression covering the different splice variants in bone marrow and blood in AML. EVI1 expression levels significantly decreased between diagnostic and post-induction samples.
25959919 EVI1 antagonizes TGF-beta-mediated growth inhibition of hepatocllular carcinoma cells.
25936528 Low EVI1 expression is associated with chronic lymphocytic leukemia.
25886616 Our data reveal MS4A3 as a novel direct target of EVI1 in human myeloid cells, and show that its repression plays a role in EVI1 mediated tumor aggressiveness.
25567132 EVI1 and MEL1 are homolog genes whose transcriptional activations by chromosomal translocations have roles in Japanese pediatric acute myeloid leukemia
25486926 There is breakpoint heterogeneity in (2;3)(p15-23;q26) translocations involving EVI1 in myeloid hemopathies found in four unrelated patients.
25486480 EVI1 modulated the all-trans retinoic acid response of several dozens of genes.
24935473 Findings suggest that the EVI-1 rs6774494 G > A single nucleotide polymorphism targeted by miRNA-206/133b may contribute to the pathogenesis of breast cancer.
24907396 We found that EVI1 and HIC1 colocalize in the nucleus, and their interaction is mediated by the amino terminal zinc finger binding domain of EVI1
24856998 Co-expression of EVI1 and BCR/ABL fusion gene can be found in childhood CML and ALL.
24828867 Data suggest that alteration of ecotropic viral integration site-1 (EVI1) expression was more profound in acute lymphoblastic leukemia (ALL) than in acute myeloid leukemia (AML).
24747972 Evi1-high leukemic cells themselves possess the superior potential to Evi1-low cells in oncogenic self-renewal.
24703906 Authors identify a mechanism whereby a GATA2 distal hematopoietic enhancer (G2DHE or -77-kb enhancer) is brought into close proximity to the EVI1 gene in inv(3)(q21;q26) inversions, leading to leukemogenesis.
24703711 3q inversion and translocation reposition a distal GATA2 enhancer to ectopically activate EVI1 and simultaneously confer GATA2 functional haploinsufficiency, previously identified as the cause of sporadic familial acute myeloid leukemia/myelodysplastic syndrome.
24568904 EVI1-positive children with acute myeloid leukemia have a poor short-term prognosis
24055488 The MECOM core promoter GA-repeats are also conserved in numerous species, of which human has the longest repeat and complexity.
24021671 PR-domain protein ME has an essential role in mixed-lineage leukemia (MLL) fusion protein (MFP) leukemia
23858473 EVI1 oncoprotein interacts with a large and complex network of proteins and integrates signals through protein phosphorylation.
23776681 Phosphorylation of the leukemic oncoprotein EVI1 on serine 196 modulates DNA binding, transcriptional repression and transforming ability.
23752186 we found that EVI1 upregulated KRAS expression through suppression of miR-96 in pancreatic cancer cells
23665236 EVI1 binds to DeltaNp63 promoter element directly and down regulates its expression, inducing the expression of p21 in colon carcinoma cells that do not express p53, that eventually delay cell cycle progression at G0/G1 phase.
23517670 Expression of EVI1 and EVI1(Del427-515) (but not EVI1(Del190-515)) in OVCAR8 ovarian cancer cells increased cyclin E1 LMW expression and cell cycle progression.
23509296 EVI1 binds to the promoter of miR-9-3, leading to DNA hypermethylation of the promoter and repression of miR-9.
23457546 human myeloid cell line constitutively overexpressing EVI1 was partially resistant to etoposide and daunorubicin
23349225 we identified a new locus associated with OF (rs784288 in the MECOM gene) that showed genome-wide significance (p=3.59x10(-8); OR 1.39). RNA interference revealed that a MECOM knockdown suppresses osteoclastogenesis.
23212151 Cell cycle analysis demonstrated EVI1's anti-proliferative effect to be strictly dose-dependent with accumulation of cells in G0/G1
23155256 EVI1 is expressed in human hematopoietic progenitor cells, but is down-regulated during differentiation
23008312 Deregulated expression of EVI1 defines a subset of MLL-rearranged acute myeloid leukemias.
22939622 Data identify Prdm3 and Prdm16 as H3K9me1 methyltransferases and expose a functional framework in which anchoring to the nuclear periphery helps maintain the integrity of mammalian heterochromatin.
22894935 Overexpression of EVI1-HA in U2OS cells induced supernumerary centrosomes, which were consistently associated with enlarged nuclei or binuclear cells.
22887804 elevated EVI1 expression or in AML/MDS patients with chromosome 7 abnormalities.
22634393 Data indicate that application of EVI1-specific small interfering RNA decreased expression of the TEL/MDS1/EVI1 fusion.
22555662 High BRE and high EVI1 expression are mutually exclusive in MLL-AF9-positive acute myeloid leukemia patients.
22553314 EVI1 is a critical player in tumor growth in a subset of MLL-rearranged acute myeloid leukemia.
22488406 A high MEBE (MN1,ERG, BAALC, EVI1) expression score is an unfavorable prognostic marker in Myelodysplastic syndrome and is associated with an increased risk for progression to Acute myeloid leukemia.
22308434 EVI1 is a multipurpose transcription factor that synergizes with FOS in invasive tumors.
22295105 increased expression of ITGA6 is associated with drug-resistance and increased cell adhesion
22161860 Overexpression of Evi1 oncoprotein is identified as a novel mechanism by which a subset of human human colorectal cancer cells may escape TGF-beta regulation.
22033412 The results of real-time PCR analyses showed that Ang1 is highly expressed in leukemia cell lines and primary AML cells with EVI1(high) expression.
21872826 EVI1 overexpression collaborates with BCR-ABL1 in the evolution of tyrosine kinase inhibitor-resistant myeloid blast crisis.
21750091 Our results identify EVI1 over-expression as a poor prognostic marker in a large, independent cohort of acute myeloid leukemia patients less than 65 years old.
21636719 EVI1 overexpression is associated with Fanconi anemia.
21555002 Results identify an EVI1-SIRT1 axis in the regulation of EVI1 activity suggesting a possible role of SIRT1 in EVI1 positive neoplasms.
21362509 a novel regulation of Evi-1, which transactivates PLZF, by PKCdelta to induce cell death in response to genotoxic stress.
21289308 Dependence of Evi1-expressing leukemic cells on AKT/mTOR signaling provides the first example of targeted therapeutic modalities that suppress the leukemogenic activity of Evi1.
21190993 Evi-1 is one of the targets of MLL oncoproteins and is selectively activated in hematopoietic stem cell-derived MLL leukemic cells.
21176350 siRNA specific for evi1 gene can suppress the proliferation of HEL cells, reduce the expression of evi1 mRNA, decrease the cell viability, arrest the cell cycle, suppress cell mitosis, and promote cell apoptosis.
20855866 Aberrant DNA hypermethylation signature is associated with acute myeloid leukemia directed by EVI1.
20842122 EVI1 controls proliferation in acute myeloid leukemia through modulation of miR-1-2.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20532840 Proteins associated with EVI1, signaling pathways regulated by EVI1, and downstream mediators of EVI1 transcriptional regulation have been described and characterized.
20512145 Findings provide new insights into the pathogenesis of NPC by highlighting the involvement of pathways related to TNFRSF19 and MDS1-EVI1 in addition to HLA molecules.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363750 acetylation of EVI1 at Lys(564) by P/CAF enhances the DNA binding capacity of EVI1 and thereby contributes to the activation of GATA2
20357826 EVI1 is overexpressed in specific cytogenetic (MLL rearrangements and monosomy 7) and morphologic (FAB-M6/7) subtypes of pediatric acute myeloid leukemia.
20308656 EVI1 expression in acute myeloid leukemia(AML) is unequally distributed in cytogenetic subtypes. It predicts poor outcome, particularly among intermediate cytogenetic risk AML.
20098431 data show that forced overexpression of EVI1 in human cells disrupts normal centrosome duplication, linking EVI1 activation to the development of genomic instability, monosomy 7 and clonal progression toward myelodysplasia
20084277 performed high-resolution array comparative genomic hybridization analysis of twelve EVI1 overexpressing patients and three EVI1 deregulated cell lines to search for 7q submicroscopic deletions
19776757 EVI-1 interacts with histone methyltransferases SUV39H1 and G9a for transcriptional repression and bone marrow immortalization.
19767769 Pbx1 is a target gene of Evi-1 involved in Evi-1-mediated leukemogenesis.
19605700 inducible expression of EVI1 in U937 cells causes phenotypes that may be relevant for its role in MDS and provides a basis for further investigation of its contribution to this fatal disease.
19385966 biochemical properties and biological functions of EVI-1 in normal and malignant hematopoiesis, with specific focus on its pathogenetic significance in hematological malignancies.
19352083 It is a critical regulator for hematopoiesis and leukemia. (review)
19241117 both NUP98/HOXA9 and NUP98/HOXA11 enhance the activity of the EVI1 promoter
19208846 EVI1 point mutant, unable to bind PU.1, restores the activation of PU.1-regulated genes and allows a normal differentiation of bone marrow progenitors in vitro.
19010836 ETV6/RUNX1 leads to EPOR up-regulation and that activation by EPO might be of relevance to the biology of ETV6/RUNX1-positive acute lymphoblastic leukemias
18976975 Knockdown of MDS1 and EVI1 complex locus (MECOM) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18815193 The EVI1 gene locus was rearranged in all 13 myeloid malignancies patients and was associated with EVI1 overexpression. In 9 out of 13 patients, the 17q breakpoints clustered in a 250 kb region on band 17q22 encompassing the MSI2 gene
18752846 Presence of both EVI1 and/or BAALC in chronic myeloid patients was found to modulate the disease pattern
18619962 Presence of SUV39H1 enhances Evi1 transcriptional repression in a dose dependent manner; these data establish an epigenetic role of Evi1 in cell transformation by recruiting higher order chromatin remodeling complexes.
18452556 Evi-1 promotes hematopoietic stem/progenitor expansion at the embryonic stage through up-regulation of GATA-2 and repression of TGF-beta signaling.
18272813 High EVI1 predicted a distinctly worse event-free survival (HR = 1.9; P = .002) and disease-free survival (HR = 2.1, P = .006) following multivariate analysis.
18262061 Genetic alterations such as aberrant expression of the EVI1 gene may contribute to the clinical heterogeneity of chronic myeloid leukemia.
18181178 EVI1 and MDS1/EVI1 overexpression is associated with acute myeloid leukemia
17894555 Inhibition of C/EBPalpha function may be causatively related to the leukemogenic potential of RUNX1/EVI1 chimeric transcription factor.
17693194 In conclusion, the combined MDS-EVI1/EVI1 gene may serve as an alternative MRD marker in AML, especially in samples where other specific markers are lacking.
17693189 High EVI1 expression is associated with acute myeloid leukemias
17635584 ubiquitously-expressed transcript suppresses cell transformation and might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like Evi1
17507183 review of EVI1 expression, biochemical properties, and biological functions [review]
17243162 Overexpressed in Fanconi anemia-derived acute myeloid leukemia.
17014970 Murine and human forms of Evi1 with repressor domain(Rp) or Rp+9 exist, the additional 9 amino acids are encoded by a conserved 27 nucleotide exon, the overall structural organisation of the gene being preserved in the two species.
16582916 Correction of X-linked chronic granulomatous disease by gene therapy was augmented by insertional activation of MDS1.
16342172 Real-time quantitative PCR analyses indicated that typically both MDS1/EVI1 and EVI1, but not MDS1, were expressed in these malignancies, with EVI1 the primary transcript.
16014322 The general expression patterns of the EVI1 5'-end variants in a panel of 20 human tissues were similar, while pronounced differences were noted in response to all-trans retinoic acid.
15914564 human AML1/EVI1/+ knock-in mouse embryos showed defective hematopoiesis in the fetal liver; fetal liver contained multilineage progenitors capable of differentiating into dysplastic myelocyte and megakaryocyte
15897867 results suggest that oligomerization may contribute to the oncogenic potential of Evi-1-containing proteins
15849193 Evi-1 acts as a general Smad corepressor to inhibit TGF-beta-, activin-, and BMP-inducible transcription
14555651 EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity
12393383 study investigated which of the 2 gene products, AMLEVI1 or MDS1-EVI1, is involved in acute myeloid leukemia transformation and found that AMLEVI1 and not MDS1-EVI1 expression was associated with unfavorable karyotypes
11922610 Data indicate that EVI1 is involved in megakaryocytic differentiation, and the dysmegakaryocytopoiesis in 3q21q26 syndrome could be partly due to an enhanced differentiation of leukemia cells and/or megakaryocytes by constitutive expression of EVI1.

AA Sequence

MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLQE      1 - 70
IHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVF     71 - 140
TDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH    141 - 210
ADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLAD    211 - 280
YFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPAT    281 - 350
QDILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESD    351 - 420
KEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGL    421 - 490
VGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPGEVKKLQKGSSESPFDLTTKR    491 - 560
KDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHA    561 - 630
RPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPE    631 - 700
ASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSF    701 - 770
SISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE    771 - 840
DAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDEEDEDNDITG    841 - 910
KTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALDHIRHFTDSLKMRKMEDNQYS    911 - 980
EAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISH    981 - 1050
V//

Text Mined References (134)

PMID Year Title
26935937 2016 Persistent polyclonal binucleated B-cell lymphocytosis and MECOM gene amplification.
26815134 2016 Complex chromosomal rearrangements leading to MECOM overexpression are recurrent in myeloid malignancies with various 3q abnormalities.
26729571 2016 Review: Aberrant EVI1 expression in acute myeloid leukaemia.
26674644 2015 RUNX1-Evi-1 fusion gene inhibited differentiation and apoptosis in myelopoiesis: an in vivo study.
26581901 2015 Mutations in MECOM, Encoding Oncoprotein EVI1, Cause Radioulnar Synostosis with Amegakaryocytic Thrombocytopenia.
26554871 2016 Congenital thrombocytopenia in a neonate with an interstitial microdeletion of 3q26.2q26.31.
26467814 2015 Quantification of EVI1 transcript levels in acute myeloid leukemia by RT-qPCR analysis: A study by the ALFA Group.
25959919 2015 EVI1, a target gene for amplification at 3q26, antagonizes transforming growth factor-?-mediated growth inhibition in hepatocellular carcinoma.
25936528 2015 The regulatory interaction of EVI1 with the TCL1A oncogene impacts cell survival and clinical outcome in CLL.
25886616 2015 EVI1 promotes tumor growth via transcriptional repression of MS4A3.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25567132 2015 High expression of EVI1 and MEL1 is a compelling poor prognostic marker of pediatric AML.
25486926 2015 Breakpoint heterogeneity in (2;3)(p15-23;q26) translocations involving EVI1 in myeloid hemopathies.
25486480 2014 The oncogene EVI1 enhances transcriptional and biological responses of human myeloid cells to all-trans retinoic acid.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24935473 2014 Correlations of common polymorphism of EVI-1 gene targeted by miRNA-206/133b with the pathogenesis of breast cancer.
24907396 2014 Physical and functional interaction of the proto-oncogene EVI1 and tumor suppressor gene HIC1 deregulates Bcl-xL mediated block in apoptosis.
24856998 2014 [Clinical characteristics of childhood leukemia with EVI1 gene and BCR/ABL gene co-expression].
24828867 2015 Aberrant expression of ecotropic viral integration site-1 in acute myeloid leukemia and acute lymphoblastic leukemia.
24747972 2014 Evi1 defines leukemia-initiating capacity and tyrosine kinase inhibitor resistance in chronic myeloid leukemia.
24703906 2014 A remote GATA2 hematopoietic enhancer drives leukemogenesis in inv(3)(q21;q26) by activating EVI1 expression.
24703711 2014 A single oncogenic enhancer rearrangement causes concomitant EVI1 and GATA2 deregulation in leukemia.
24568904 2014 [Clinical and biological characteristics of childhood acute myeloid leukemia with EVI1 gene positive expression].
24055488 2013 Polymorphic core promoter GA-repeats alter gene expression of the early embryonic developmental genes.
24021671 2013 Essential role of PR-domain protein MDS1-EVI1 in MLL-AF9 leukemia.
23858473 2013 EVI1 oncoprotein interacts with a large and complex network of proteins and integrates signals through protein phosphorylation.
23776681 2013 Phosphorylation of the leukemic oncoprotein EVI1 on serine 196 modulates DNA binding, transcriptional repression and transforming ability.
23752186 2014 EVI1 oncogene promotes KRAS pathway through suppression of microRNA-96 in pancreatic carcinogenesis.
23665236 2013 EVI1 targets ?Np63 and upregulates the cyclin dependent kinase inhibitor p21 independent of p53 to delay cell cycle progression and cell proliferation in colon cancer cells.
23517670 2013 EVI1 splice variants modulate functional responses in ovarian cancer cells.
23509296 2013 Critical role of miR-9 in myelopoiesis and EVI1-induced leukemogenesis.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23457546 2013 EVI1 inhibits apoptosis induced by antileukemic drugs via upregulation of CDKN1A/p21/WAF in human myeloid cells.
23349225 2013 Meta-analysis identifies a MECOM gene as a novel predisposing factor of osteoporotic fracture.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23212151 2013 Activation of Evi1 inhibits cell cycle progression and differentiation of hematopoietic progenitor cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23155256 2012 EVI1 and MDS1/EVI1 expression during primary human hematopoietic progenitor cell differentiation into various myeloid lineages.
23008312 2013 Deregulated expression of EVI1 defines a poor prognostic subset of MLL-rearranged acute myeloid leukemias: a study of the German-Austrian Acute Myeloid Leukemia Study Group and the Dutch-Belgian-Swiss HOVON/SAKK Cooperative Group.
22939622 2012 Prdm3 and Prdm16 are H3K9me1 methyltransferases required for mammalian heterochromatin integrity.
22894935 2012 Overexpression of EVI1 interferes with cytokinesis and leads to accumulation of cells with supernumerary centrosomes in G0/1 phase.
22887804 2012 Three novel cytogenetically cryptic EVI1 rearrangements associated with increased EVI1 expression and poor prognosis identified in 27 acute myeloid leukemia cases.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22634393 2012 CML cells expressing the TEL/MDS1/EVI1 fusion are resistant to imatinib-induced apoptosis through inhibition of BAD, but are resensitized with ABT-737.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22555662 2012 Improved classification of MLL-AF9-positive acute myeloid leukemia patients based on BRE and EVI1 expression.
22553314 2012 EVI1 is critical for the pathogenesis of a subset of MLL-AF9-rearranged AMLs.
22488406 2012 Prognostic significance of combined MN1, ERG, BAALC, and EVI1 (MEBE) expression in patients with myelodysplastic syndromes.
22308434 2012 Ecotopic viral integration site 1 (EVI1) regulates multiple cellular processes important for cancer and is a synergistic partner for FOS protein in invasive tumors.
22295105 2012 The increased expression of integrin ?6 (ITGA6) enhances drug resistance in EVI1(high) leukemia.
22161860 2013 Overexpression of Evi-1 oncoprotein represses TGF-? signaling in colorectal cancer.
22033412 2011 Angiopoietin1 contributes to the maintenance of cell quiescence in EVI1(high) leukemia cells.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21872826 2011 Frequent EVI1 translocations in myeloid blast crisis CML that evolves through tyrosine kinase inhibitors.
21782286 2011 A genome-wide association study of aging.
21750091 2011 Down-regulation of EVI1 is associated with epigenetic alterations and good prognosis in patients with acute myeloid leukemia.
21636719 2011 Fanconi anemia (FA)-associated 3q gains in leukemic transformation consistently target EVI1, but do not affect low TERC expression in FA.
21555002 EVI1 up-regulates the stress responsive gene SIRT1 which triggers deacetylation and degradation of EVI1.
21362509 2011 Identification of Evi-1 as a novel effector of PKC? in the apoptotic response to DNA damage.
21289308 2011 Evi1 represses PTEN expression and activates PI3K/AKT/mTOR via interactions with polycomb proteins.
21190993 2011 Evi-1 is a transcriptional target of mixed-lineage leukemia oncoproteins in hematopoietic stem cells.
21176350 2010 [Inhibition of evi1 expression by siRNA in HEL cell line].
20855866 2011 Aberrant DNA hypermethylation signature in acute myeloid leukemia directed by EVI1.
20842122 2010 EVI1 controls proliferation in acute myeloid leukaemia through modulation of miR-1-2.
20700443 2010 Genome-wide association studies of serum magnesium, potassium, and sodium concentrations identify six Loci influencing serum magnesium levels.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20532840 2010 Evi-1 as a critical regulator of leukemic cells.
20512145 2010 A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363750 2010 Acetylation of lysine 564 adjacent to the C-terminal binding protein-binding motif in EVI1 is crucial for transcriptional activation of GATA2.
20357826 2010 EVI1 overexpression in distinct subtypes of pediatric acute myeloid leukemia.
20308656 2010 High EVI1 expression predicts outcome in younger adult patients with acute myeloid leukemia and is associated with distinct cytogenetic abnormalities.
20098431 2010 Genomic instability and myelodysplasia with monosomy 7 consequent to EVI1 activation after gene therapy for chronic granulomatous disease.
20084277 2010 Identification of two critically deleted regions within chromosome segment 7q35-q36 in EVI1 deregulated myeloid leukemia cell lines.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19776757 2010 EVI-1 interacts with histone methyltransferases SUV39H1 and G9a for transcriptional repression and bone marrow immortalization.
19767769 2009 Pbx1 is a downstream target of Evi-1 in hematopoietic stem/progenitors and leukemic cells.
19605700 2009 Inducible expression of EVI1 in human myeloid cells causes phenotypes consistent with its role in myelodysplastic syndromes.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19430479 2009 Genome-wide association study of blood pressure and hypertension.
19385966 2009 Pathogenetic significance of ecotropic viral integration site-1 in hematological malignancies.
19352083 2009 [Pathogenetic significance of deregulated hematopoietic transcription factors in leukemia--Evi-1 as a critical regulator for hematopoiesis and leukemia].
19241117 2009 Enhanced expression of the EVI1 gene in NUP98/HOXA-expressing leukemia cells.
19208846 2009 EVI1 Impairs myelopoiesis by deregulation of PU.1 function.
19010836 2008 Role of the erythropoietin receptor in ETV6/RUNX1-positive acute lymphoblastic leukemia.
18815193 2008 EVI1 overexpression in t(3;17) positive myeloid malignancies results from juxtaposition of EVI1 to the MSI2 locus at 17q22.
18752846 2009 EVI1, BAALC and AME: prevalence of the secondary mutations in chronic and accelerated phases of chronic myeloid leukemia patients from eastern India.
18619962 2008 A novel interaction between the proto-oncogene Evi1 and histone methyltransferases, SUV39H1 and G9a.
18452556 2008 Evi-1 promotes para-aortic splanchnopleural hematopoiesis through up-regulation of GATA-2 and repression of TGF-b signaling.
18272813 2008 High EVI1 levels predict adverse outcome in acute myeloid leukemia: prevalence of EVI1 overexpression and chromosome 3q26 abnormalities underestimated.
18262061 2008 Philadelphia chromosome-positive chronic myeloid leukemia with p190(BCR-ABL) rearrangement, overexpression of the EVI1 gene, and extreme thrombocytosis: a case report.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18181178 2008 Expression and prognostic significance of different mRNA 5'-end variants of the oncogene EVI1 in 266 patients with de novo AML: EVI1 and MDS1/EVI1 overexpression both predict short remission duration.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17894555 2007 RUNX1/EVI1, which blocks myeloid differentiation, inhibits CCAAT-enhancer binding protein alpha function.
17693194 2007 Feasibility of using the combined MDS-EVI1/EVI1 gene expression as an alternative molecular marker in acute myeloid leukemia: a report of four cases.
17693189 2007 Aberrant EVI1 expression in acute myeloid leukemias associated with the t(3;8)(q26;q24).
17635584 2007 UXT interacts with the transcriptional repressor protein EVI1 and suppresses cell transformation.
17507183 2007 The oncogene and developmental regulator EVI1: expression, biochemical properties, and biological functions.
17243162 2007 Amplification and translocation of 3q26 with overexpression of EVI1 in Fanconi anemia-derived childhood acute myeloid leukemia with biallelic FANCD1/BRCA2 disruption.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17014970 2006 Conservation and expression of a novel alternatively spliced Evi1 exon.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16582916 2006 Correction of X-linked chronic granulomatous disease by gene therapy, augmented by insertional activation of MDS1-EVI1, PRDM16 or SETBP1.
16462766 2006 Evi1 is a survival factor which conveys resistance to both TGFbeta- and taxol-mediated cell death via PI3K/AKT.
16342172 2006 EVI1 is consistently expressed as principal transcript in common and rare recurrent 3q26 rearrangements.
16014322 2005 Regulation of the expression of the oncogene EVI1 through the use of alternative mRNA 5'-ends.
15914564 2005 Dysplastic definitive hematopoiesis in AML1/EVI1 knock-in embryos.
15897867 2005 Oligomerization of Evi-1 regulated by the PR domain contributes to recruitment of corepressor CtBP.
15849193 2005 Repression of bone morphogenetic protein and activin-inducible transcription by Evi-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14555651 2003 EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461752 2003 Quantitative comparison of the expression of EVI1 and its presumptive antagonist, MDS1/EVI1, in patients with myeloid leukemia.
12393383 2003 High EVI1 expression predicts poor survival in acute myeloid leukemia: a study of 319 de novo AML patients.
11568182 2001 Interaction of EVI1 with cAMP-responsive element-binding protein-binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles.
11328817 2001 Evi-1 transforming and repressor activities are mediated by CtBP co-repressor proteins.
11313276 2001 The corepressor CtBP interacts with Evi-1 to repress transforming growth factor beta signaling.
11181995 2001 The sequence of the human genome.
11050005 2000 A novel gene, MEL1, mapped to 1p36.3 is highly homologous to the MDS1/EVI1 gene and is transcriptionally activated in t(1;3)(p36;q21)-positive leukemia cells.
10856240 2000 The evi-1 oncoprotein inhibits c-Jun N-terminal kinase and prevents stress-induced cell death.
9724649 1998 Cloning and characterization of mCtBP2, a co-repressor that associates with basic Krüppel-like factor and other mammalian transcriptional regulators.
9665135 1998 The oncoprotein Evi-1 represses TGF-beta signalling by inhibiting Smad3.
8700545 1996 Structurally altered Evi-1 protein generated in the 3q21q26 syndrome.
8643684 1996 Intergenic splicing of MDS1 and EVI1 occurs in normal tissues as well as in myeloid leukemia and produces a new member of the PR domain family.
8557637 1996 Zinc fingers 1-7 of EVI1 fail to bind to the GATA motif by itself but require the core site GACAAGATA for binding.
8313895 1994 Generation of the AML1-EVI-1 fusion gene in the t(3;21)(q26;q22) causes blastic crisis in chronic myelocytic leukemia.
8171026 1994 Consistent intergenic splicing and production of multiple transcripts between AML1 at 21q22 and unrelated genes at 3q26 in (3;21)(q26;q22) translocations.
2115646 1990 Unique expression of the human Evi-1 gene in an endometrial carcinoma cell line: sequence of cDNAs and structure of alternatively spliced transcripts.