Property Summary

NCBI Gene PubMed Count 23
PubMed Score 2.40
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.700 8.3e-03
ependymoma -1.800 1.6e-02
oligodendroglioma -1.600 1.5e-02
atypical teratoid / rhabdoid tumor -1.400 7.0e-06
glioblastoma -1.200 4.3e-04
medulloblastoma, large-cell -1.200 1.8e-04
Breast cancer 3.700 2.2e-02
lung carcinoma 1.600 4.3e-33
ovarian cancer 1.400 1.1e-02

Gene RIF (1)

PMID Text
24530230 present two more ESS with MEAF6/PHF1 detected by transcriptome sequencing (case 1) and RT-PCR (case 2), proving that this fusion is recurrent in ESS

AA Sequence

MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN      1 - 70
SNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDP     71 - 140
EDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY                       141 - 191
//

Text Mined References (34)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24530230 2014 MEAF6/PHF1 is a recurrent gene fusion in endometrial stromal sarcoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22761769 2012 Novel fusion of MYST/Esa1-associated factor 6 and PHF1 in endometrial stromal sarcoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19060904 2009 An empirical framework for binary interactome mapping.
18794358 2008 Molecular architecture of quartet MOZ/MORF histone acetyltransferase complexes.
18684714 2008 Role of Jade-1 in the histone acetyltransferase (HAT) HBO1 complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.