Property Summary

NCBI Gene PubMed Count 8
PubMed Score 71.94
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4473 8.2e-04
ovarian cancer 8491 2.2e-03
Disease Target Count Z-score Confidence
Myoma 12 3.531 1.8
Parkinson's disease 364 3.192 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.200 8.2e-04
ovarian cancer 1.300 2.2e-03

AA Sequence

MGPERHLSGAPARMATVVLGGDTMGPERIFPNQTEELGHQGPSEGTGDWSSEEPEEEQEETGSGPAGYSY      1 - 70
QPLNQDPEQEEVELAPVGDGDVVADIQDRIQALGLHLPDPPLESEDEDEEGATALNNHSSIPMDPEHVEL     71 - 140
VKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK                             141 - 185
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12755172 2003 Peas-Mea1-Ppp2r5d overlapping gene complex: a transposon mediated-gene formation in mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444059 2002 Male-enhanced antigen-1 gene flanked by two overlapping genes is expressed in late spermatogenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2813404 1989 Male-enhanced antigen gene is phylogenetically conserved and expressed at late stages of spermatogenesis.