Property Summary

NCBI Gene PubMed Count 33
PubMed Score 82.65
PubTator Score 266.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.107 2.0e-02
Multiple myeloma 1.295 5.6e-03
osteosarcoma 1.253 9.0e-03
sonic hedgehog group medulloblastoma 1.400 1.7e-03
glioblastoma 1.300 2.8e-02
atypical teratoid/rhabdoid tumor 1.400 4.7e-04
medulloblastoma, large-cell 1.400 2.7e-04
Breast cancer 2.800 2.6e-02
primary Sjogren syndrome 1.400 1.9e-04
aldosterone-producing adenoma -1.081 4.3e-02
ovarian cancer -1.800 2.7e-07

Gene RIF (13)

PMID Text
25202825 ME2 might be an important factor in melanoma progression and a novel biomarker of invasion.
24957098 Data indicate that malic enzyme 2 knockdown impacts phosphatidylinositol 3-kinases/proto-oncogene protein akt (PI3K/AKT) signaling.
23756480 Three SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myclonic epilepsy.
23334421 p53 represses the expression of the tricarboxylic-acid-cycle-associated malic enzymes ME1 and ME2 in human and mouse cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20824065 Depletion of malic enzyme 2 induced erythroid differentiation in human erythroleukemia cells.
19691144 ME2 activity in Islets of Langerhans cells was measured by a spectrophotometric enzyme assay by utilizing the distinct kinetic properties.
19066393 Single nucleotide polymorphism in ME2 gene is associated with acute lymphoblastic leukemia.
17638511 Schizophrenic subjects are identified with mitochondrial genes involved in oxidative metabolism as showing consistently decreased expression, including ME2.
17418816 These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes.
16190936 Observational study of gene-disease association. (HuGE Navigator)
16171388 Site directed mutagenesis was used to detrmine which amino acids in the active site of human mitochondrial NAD+-dependent malic enzyme are necessary for the inhibitory effects of ATP.
15532013 An ME2-centered nine-SNP haplotype, when present homozygously, increases the risk for IGE (odds ratio 6.1; 95% confidence interval 2.9-12.7) compared with any other genotype

AA Sequence

MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHR      1 - 70
NLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDR     71 - 140
GHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNI    141 - 210
ALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDI    211 - 280
QGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLL    281 - 350
VKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALS    351 - 420
NPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSV    421 - 490
FLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRS    491 - 560
EYDSLLPDVYEWPESASSPPVITE                                                  561 - 584
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25202825 2015 Human mitochondrial NAD(P)(+)-dependent malic enzyme participates in cutaneous melanoma progression and invasion.
24957098 2014 Knockdown of malic enzyme 2 suppresses lung tumor growth, induces differentiation and impacts PI3K/AKT signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23756480 2013 The quest for juvenile myoclonic epilepsy genes.
23334421 2013 Reciprocal regulation of p53 and malic enzymes modulates metabolism and senescence.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20824065 2010 Induction of erythroid differentiation in human erythroleukemia cells by depletion of malic enzyme 2.
19691144 2009 Mitochondrial malic enzyme (ME2) in pancreatic islets of the human, rat and mouse and clonal insulinoma cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19066393 2009 Acquired variation outweighs inherited variation in whole genome analysis of methotrexate polyglutamate accumulation in leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17638511 2007 Variation in the malic enzyme 2 gene: implications for the pharmacogenomics of psychotic disorders.
17418816 2007 Human spot 14 protein interacts physically and functionally with the thyroid receptor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16190936 2005 Association analysis of malic enzyme 2 gene polymorphisms with idiopathic generalized epilepsy.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16171388 2005 Functional roles of ATP-binding residues in the catalytic site of human mitochondrial NAD(P)+-dependent malic enzyme.
15532013 2005 Malic enzyme 2 may underlie susceptibility to adolescent-onset idiopathic generalized epilepsy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12962632 2003 Crystal structures of substrate complexes of malic enzyme and insights into the catalytic mechanism.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121650 2002 Molecular mechanism for the regulation of human mitochondrial NAD(P)+-dependent malic enzyme by ATP and fumarate.
11401430 2001 Physical and transcriptional map of a 311-kb segment of chromosome 18q21, a candidate lung tumor suppressor locus.
11358520 2001 Cloning and functional characterization of the 5' flanking region of the human mitochondrial malic enzyme gene. Regulatory role of Sp1 and AP-2.
10913357 2000 Potent and competitive inhibition of malic enzymes by lanthanide ions.
10700286 2000 Structure of a closed form of human malic enzyme and implications for catalytic mechanism.
10477256 1999 Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme: a new class of oxidative decarboxylases.
10467136 1999 Crystal structure of human mitochondrial NAD(P)(+)-dependent malic enzyme: a new class of oxidative decarboxylases.
7757881 1995 Purification and properties of cytosolic and mitochondrial malic enzyme isolated from human brain.
7496989 1995 Different regulatory properties of the cytosolic and mitochondrial forms of malic enzyme isolated from human brain.
3689803 1987 Evidence for two distinct mitochondrial malic enzymes in human skeletal muscle: purification and properties of the NAD(P)+-dependent enzyme.
1993674 1991 Human NAD(+)-dependent mitochondrial malic enzyme. cDNA cloning, primary structure, and expression in Escherichia coli.
680703 1978 Further data on mitochondrial malic enzyme in man.
511162 1979 Mitochondrial malic enzyme (E.C.1.1.1.40) in human leukocytes: formal genetics and population genetics.