Property Summary

NCBI Gene PubMed Count 33
PubMed Score 90.34
PubTator Score 819.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Rheumatoid Arthritis 1.900 2.6e-02
astrocytic glioma -3.000 5.8e-03
posterior fossa group B ependymoma -3.100 1.2e-08
oligodendroglioma -2.300 2.7e-02
psoriasis 2.200 1.5e-04
glioblastoma -1.700 4.5e-02
osteosarcoma 2.086 3.3e-03
medulloblastoma -3.100 3.3e-07
atypical teratoid / rhabdoid tumor -3.700 1.6e-06
medulloblastoma, large-cell -3.800 8.7e-07
primitive neuroectodermal tumor -2.000 7.0e-03
Amyotrophic Lateral Sclerosis 1.171 7.6e-05
acute quadriplegic myopathy 1.069 2.2e-03
Atopic dermatitis -1.400 3.1e-03
tuberculosis and treatment for 3 months -1.100 1.1e-02
intraductal papillary-mucinous adenoma (... 1.600 7.2e-03
intraductal papillary-mucinous carcinoma... 1.700 9.6e-03
colon cancer 1.700 3.3e-02
lung cancer 3.500 1.3e-05
active Crohn's disease 1.886 3.9e-02
active ulcerative colitis 2.788 2.8e-02
breast carcinoma -1.600 2.4e-03
fibroadenoma -2.200 2.6e-02
adult high grade glioma -1.600 1.8e-02
nasopharyngeal carcinoma -1.100 2.8e-02
Breast cancer 1.700 1.3e-03
mucosa-associated lymphoid tissue lympho... 2.888 3.8e-02
ductal carcinoma in situ -1.800 2.7e-02
ovarian cancer -3.400 2.3e-14

Gene RIF (14)

PMID Text
26173780 ME1 expression was found to be mutant-KRAS-associated in NSCLC cancer cell lines. Patients with elevated ME1 had worse outcomes after radiotherapy. Transamination generating cytosolic NADPH via ME1 may contribute to radioresistance.
25753478 ME1 overexpression associates with unfavorable prognoses in patients with HCC, suggesting that ME1 is a poor prognostic predictor of hepatocellular carcinoma.
23334421 p53 represses the expression of the tricarboxylic-acid-cycle-associated malic enzymes ME1 and ME2 in human and mouse cells
23284632 the differential protein stability between dimer and tetramer interface interactions of human c-NADP-ME
23114090 essential role for ME1 in the production of cytosolic NADPH and maintenance of migratory and invasive abilities of nasopharyngeal carcinoma cells
22456781 cytosolic malic enzyme 1 gene polymorphism is associated with the degree of suppression of parathyroid hormone after long-term calcium supplementation; the effect is probably mediated through an increase in intestinal calcium absorption
21555518 ME1 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19464998 A series of R98/D102 mutants examined the possible interactions between Arg98 and Asp102 using double-mutant cycle analysis. Kinetic analysis revealed that the catalytic efficiency of was severely affected by mutating both Arg98 and Asp102 residues.
19416979 human c-NADP-ME exists mainly as a tetramer, whereas human m-NAD(P)-ME exists as a mixture of dimers and tetramers
19293334 although ME1 overexpression augments anaplerosis and glucose stimulated insulin secretion in INS-1 832/13 cells, it is not likely involved in methyl succinate and glucose stimulated insulin secretion in pancreatic islets
18660489 Observational study of gene-disease association. (HuGE Navigator)
16757477 that the single mutation of Gln362 to Lys in human m-NAD-ME changes it to an NADP+-dependent enzyme, which is characteristic because it is non-allosteric, non-cooperative, and NADP+-specific
11352855 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFD      1 - 70
RYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAW     71 - 140
PEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIG    141 - 210
LRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAG    211 - 280
LLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQE    281 - 350
KEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC    351 - 420
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVS    421 - 490
DKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWP    491 - 560
EEVQKIQTKVDQ                                                              561 - 572
//

Text Mined References (36)

PMID Year Title
26173780 2015 Mutant KRAS associated malic enzyme 1 expression is a predictive marker for radiation therapy response in non-small cell lung cancer.
25753478 2015 Malic enzyme 1 induces epithelial-mesenchymal transition and indicates poor prognosis in hepatocellular carcinoma.
23334421 2013 Reciprocal regulation of p53 and malic enzymes modulates metabolism and senescence.
23284632 2012 Biophysical characterization of the dimer and tetramer interface interactions of the human cytosolic malic enzyme.
23114090 2012 Repressing malic enzyme 1 redirects glucose metabolism, unbalances the redox state, and attenuates migratory and invasive abilities in nasopharyngeal carcinoma cell lines.
22456781 2012 Malic enzyme gene polymorphism is associated with responsiveness in circulating parathyroid hormone after long-term calcium supplementation.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19464998 2009 Long-range interaction between the enzyme active site and a distant allosteric site in the human mitochondrial NAD(P)+-dependent malic enzyme.
19416979 2009 Functional roles of the tetramer organization of malic enzyme.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19293334 2009 Role for malic enzyme, pyruvate carboxylation, and mitochondrial malate import in glucose-stimulated insulin secretion.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16757477 2006 Determinants of the dual cofactor specificity and substrate cooperativity of the human mitochondrial NAD(P)+-dependent malic enzyme: functional roles of glutamine 362.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121650 2002 Molecular mechanism for the regulation of human mitochondrial NAD(P)+-dependent malic enzyme by ATP and fumarate.
11358520 2001 Cloning and functional characterization of the 5' flanking region of the human mitochondrial malic enzyme gene. Regulatory role of Sp1 and AP-2.
11352855 2001 The interaction between microsomal epoxide hydrolase polymorphisms and cumulative cigarette smoking in different histological subtypes of lung cancer.
11085912 2001 A new locus for autosomal dominant dilated cardiomyopathy identified on chromosome 6q12-q16.
9174159 1997 Molecular cloning and functional characterization of the human cytosolic malic enzyme promoter: thyroid hormone responsiveness.
8804575 1996 Nonidentity of the cDNA sequence of human breast cancer cell malic enzyme to that from the normal human cell.
8187880 1994 Characterization of cytosolic malic enzyme in human tumor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7757881 1995 Purification and properties of cytosolic and mitochondrial malic enzyme isolated from human brain.
7622060 1995 Cloning, sequencing and functional expression of a cDNA encoding a NADP-dependent malic enzyme from human liver.
7496989 1995 Different regulatory properties of the cytosolic and mitochondrial forms of malic enzyme isolated from human brain.
4689040 1973 Assignment of the genes for malate oxidoreductase decarboxylating to chromosome 6 and peptidase B and lactate dehydrogenase B to chromosome 12 in man.
3169368 1988 Purification and properties of cytosolic malic enzyme from human skeletal muscle.
2015102 1991 Human malic enzymes in heart and muscle: evidence of a selective distribution.
1088824 1975 Sub-unit structure of soluble and mitochondrial malic enzyme: demonstration of human mitochondrial enzyme in human-mouse hybrids.