Property Summary

Ligand Count 3
NCBI Gene PubMed Count 35
PubMed Score 92.84
PubTator Score 819.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 1.886 3.9e-02
active ulcerative colitis 2.788 2.8e-02
acute quadriplegic myopathy 1.069 2.2e-03
adult high grade glioma -1.600 1.8e-02
Amyotrophic lateral sclerosis 1.171 7.6e-05
astrocytic glioma -3.000 5.8e-03
Atopic dermatitis -1.400 3.1e-03
atypical teratoid / rhabdoid tumor -3.700 1.6e-06
Breast cancer 1.300 8.1e-03
breast carcinoma -1.600 2.4e-03
colon cancer 1.700 3.3e-02
ductal carcinoma in situ -1.800 2.7e-02
ependymoma -3.000 3.9e-02
fibroadenoma -2.200 2.6e-02
glioblastoma -1.700 4.5e-02
group 3 medulloblastoma -2.800 6.2e-04
intraductal papillary-mucinous adenoma (... 1.400 4.0e-02
intraductal papillary-mucinous carcinoma... 1.700 9.6e-03
lung cancer 2.500 2.1e-05
medulloblastoma, large-cell -3.800 8.7e-07
mucosa-associated lymphoid tissue lympho... 2.888 3.8e-02
nasopharyngeal carcinoma -1.100 2.8e-02
oligodendroglioma -2.300 2.7e-02
osteosarcoma 2.086 3.3e-03
ovarian cancer -3.400 2.3e-14
primitive neuroectodermal tumor -2.000 7.0e-03
psoriasis 1.100 2.9e-03
Rheumatoid arthritis 1.700 6.4e-03
tuberculosis and treatment for 3 months -1.100 1.1e-02

Gene RIF (16)

AA Sequence

MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFD      1 - 70
RYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAW     71 - 140
PEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIG    141 - 210
LRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAG    211 - 280
LLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQE    281 - 350
KEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC    351 - 420
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVS    421 - 490
DKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWP    491 - 560
EEVQKIQTKVDQ                                                              561 - 572
//

Text Mined References (38)

PMID Year Title