Property Summary

NCBI Gene PubMed Count 5
PubMed Score 49.88
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 9.0e-07
medulloblastoma, large-cell 6241 2.3e-04
tuberculosis 2010 8.2e-04
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Decubitus ulcer 13 5.185 2.6
Dementia 175 3.579 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 2.3e-04
osteosarcoma -1.090 9.0e-07
tuberculosis 1.100 8.2e-04

Gene RIF (2)

AA Sequence

MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMRGGARGRPQLT      1 - 70
LERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPCEDPARGWLSANPGREPSPGICWHLNLGLPSLHNCEE     71 - 140
//

Text Mined References (5)

PMID Year Title