Property Summary

Ligand Count 44
NCBI Gene PubMed Count 205
PubMed Score 200.76
PubTator Score 187.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.196 3.5e-05
diabetes mellitus -1.200 3.6e-03
ependymoma 1.100 1.3e-06
group 3 medulloblastoma 1.400 7.5e-04
intraductal papillary-mucinous adenoma (... 1.400 6.6e-03
juvenile dermatomyositis 1.407 1.1e-13
malignant mesothelioma 1.700 1.2e-03
medulloblastoma, large-cell 1.100 7.2e-03
oligodendroglioma 1.200 2.0e-02
osteosarcoma -2.199 1.2e-08
ovarian cancer -2.200 7.5e-08
Pick disease 1.100 6.2e-06
primitive neuroectodermal tumor 1.200 7.1e-03
psoriasis -1.100 2.8e-03
tuberculosis and treatment for 6 months 1.300 8.8e-06

 GO Component (2)

Protein-protein Interaction (11)

PDB (22)

Gene RIF (162)

AA Sequence

MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQE      1 - 70
QHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSA     71 - 140
EESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNY    141 - 210
TPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGK    211 - 280
NDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIP    281 - 350
EKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ    351 - 420
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA    421 - 490
//

Text Mined References (207)

PMID Year Title