Property Summary

Ligand Count 1,448
NCBI Gene PubMed Count 1,335
PubMed Score 2313.88
PubTator Score 2386.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 6.785 3.4
Disease Target Count Z-score Confidence
Lipoma 32 5.518 2.8
Fibrous dysplasia 15 3.171 1.6

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma 2.388 5.3e-03
active Crohn's disease 1.022 3.1e-02
acute quadriplegic myopathy 1.871 4.1e-07
Amyotrophic lateral sclerosis 1.066 2.1e-06
atypical teratoid / rhabdoid tumor 1.200 3.6e-06
autosomal dominant Emery-Dreifuss muscul... 1.253 2.1e-04
colon cancer -2.200 2.7e-04
gastric cancer 1.200 5.3e-04
glioblastoma 1.200 1.5e-05
hepatocellular carcinoma 1.400 6.7e-05
juvenile dermatomyositis 1.355 5.6e-11
lung cancer -1.200 1.2e-02
malignant mesothelioma -1.300 1.5e-03
ovarian cancer 1.100 8.2e-03
pancreatic cancer 1.300 7.3e-03
pancreatic carcinoma 1.300 7.3e-03
primitive neuroectodermal tumor 1.100 6.0e-04
psoriasis -2.500 4.9e-05
subependymal giant cell astrocytoma 1.471 1.0e-02

Protein-protein Interaction (3)

PDB (86)

Gene RIF (1278)

AA Sequence

MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEK      1 - 70
QQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQ     71 - 140
ELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERS    141 - 210
SSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTV    211 - 280
YQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENS    281 - 350
TQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ    351 - 420
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYF    421 - 490
P//

Text Mined References (1345)

PMID Year Title