Property Summary

NCBI Gene PubMed Count 136
PubMed Score 580.46
PubTator Score 121.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2714 2.3e-15
Breast cancer 3098 2.4e-05
Disease Target Count Z-score Confidence
Cancer 2346 4.518 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 3.200 2.3e-15
Breast cancer 2.000 2.4e-05

Gene RIF (108)

PMID Text
27089523 The concentration of MDK in amniotic fluid declined with gestational age.MDK concentrations in amniotic fluid were far higher than in maternal plasma.
26656665 MDK plays an important role in non-small cell lung cancer progression and prognosis and may act as a convincing prognostic indicator for non-small cell lung cancer patients.
26642712 PLSCR1 positively regulates hepatic carcinoma cell proliferation and migration through interacting with midkine
26566633 MK was significantly elevated in vitamin D deficiency and associated with anti-Saccharomyces cerevisiae antibodies positivity which was significantly increased in vitamin D deficiency
26297257 our results suggest that midkine expression could be a clinically useful marker in predicting the presence of multiple lymph node metastases in BRAFV600E papillary thyroid carcinoma.
26159850 overexpression of midkine protein serves as an unfavorable prognostic biomarker in breast cancer patients
25817231 midkine is as good as or even better than thyroglobulin to screen patients with thyroid nodules for differentiated thyroid cancer before surgery, and to predict whether metastases exist
25787827 The Circulating Levels of Selenium, Zinc, Midkine, Some Inflammatory Cytokines, and Angiogenic Factors in Mitral Chordae Tendineae Rupture.
25655295 Use hybrid-type modified chitosan derivative nanoparticles to deliver midkine-siRNA to HepG2 cells.
25428991 SP1 directly up-regulated the expression of midkine (MDK), and the SP1-MDK axis cooperated in glioma tumorigenesis.
25355294 Results from targeted sequencing in patients with acute lymphoblastic leukemia identified KMT2D and KIF1B as novel putative driver genes and a putative regulatory non-coding variant that coincided with overexpression of the growth factor MDK.
25283079 Midkine protein level is significantly higher in the papillary thyroid cancer than in the multi-nodular goiter patients.
25056169 High levels of midkine in severe peripheral artery disease patients introduce this cytokine as a possible novel effector in the advanced atherosclerotic process.
25017879 High expression levels of Midkine in gastric cardiac adenocarcinoma tissues may indicate a differentiation stage that is characteristic of malignancy, a late clinical stage and a poor prognosis.
25001988 MK expression in glioma was higher than in paratumor tissues. Overexpression was associated with the WHO grade, low Karnofsky score, time to recurrence, and poor survival. Co-expression of pleiotrophin and MK had a worse prognosis than either alone.
24659893 frequently expressed in pancreatic cancer and associated with perineural invasion
24567526 Study presents novel MK functions and new upstream signaling effectors that induce its expression to promote PDAC.
24516630 MK was expressed in adipocytes and regulated by inflammatory modulators. a significant increase in MK levels was observed in adipose tissue of obese ob/ob mice as well as in serum of overweight/obese subjects when compared with their respective controls.
24500281 PKCdelta/midkine axis mediates hypoxic proliferation and differentiation of lung epithelial cells.
24272599 Midkine is specifically expressed in papillary thyroid cancer tissues and is associated with clinicopathological features and BRAF mutation.
24164595 MK might play an important role in the progression of HNSCC and may be a useful prognostic factor
24043271 Data shows the possibility that Staphylococcus aureus modulates and corrupts host airway defense lines such as MK by fragmentation in both immuno-competent and -suppressed patient groups.
23899719 Circulating Midkine is significantly higher in malignant and non-malignant colorectal diseases than in apparently healthy individuals with more pronounced elevation in colorectal cancer than in non-malignant conditions.
23815177 High MK expression was found in cystic fibrosis lung tissue compared with control samples, involving epithelia of the large and small airways, alveoli, and cells of the submucosa (i.e., neutrophils and mast cells).
23719264 serum MDK level was significantly decreased in patients with hepatocellular carcinomas after curative resection and re-elevated when tumor relapse occurred.
23553629 The MDK signal peptide contains both subdominant and cryptic CD4+ T cell epitopes.
23391998 This study shows that airway epithelial cells of large airways and alveoli have a constitutive production of MK that is part of the bactericidal activity present in the air surface liquid, at least in vitro, and may thus be an important part of this arm of airway host defense.
23243020 Findings indicate a critical role for the midkine-Notch2 signaling axis in neuroblastoma tumorigenesis, which implicates new strategies to treat neuroblastoma.
23224432 High MDK expression is associated with non-small cell lung cancer.
23212314 High MDK expression is associated with malignant pleural effusions.
23129424 MDK upregulation in castration resistant prostate cancer is associated with neuroendicrine differentiation (shown by its relation to CGA and TUBB3).
22871361 Soluble rhMDK, rmMDK and rhPTN were expressed at a high-level and the protein was purified by a one-step purification using heparin affinity chromatography. Activity of purified rhMDK and rhPTN was confirmed by a cell proliferation assay.
22707563 Identify endothelial cells as the source of soluble midkine in the vascular system during hypoxia and defined midkine as a pivotal player of angiogenesis during ischemia in nonmalignant tissue.
22672821 Identify midkine interacting proteins in liver tumor cells.
22669742 Estradiol induces the expression of midkine protein in lung cancer cells through the estrogen receptor beta activation pathway
22562257 Midkine is differently expressed in tumors arising from colonic and rectal mucosa, where it may play diverse roles in carcinogenesis.
22417224 Letter: Plasma levels of midkine are not associated with plasma fibrinolytic potential or risk of venous thrombosis.
22415659 The results showed that midkine expression in gastric tumor cells indirectly suppresses natural killer cytotoxicity by inducing MICA/B expression and suppressing NKG2D expression.
22249249 Data indicate that ARMCX2, COL1A1, MDK, MEST and MLH1 genes acquired methylation in drug-resistant ovarian cancer-sustaining (side population) cells.
22051879 Expression of MK and VEGF is increased in gastric cancer and increased expression is closely correlated with poor prognosis and survival
21989914 Results demonstrate that the extent and timing of sympathetic neurogenesis is controlled by Midkine and Alk signaling.
21917682 Serum midkine levels can be useful to monitor hepatocellular carcinoma progression
21826666 Increased midkine expression correlates with desmoid tumour recurrence.
21787488 Quantitative analysis of MK messenger RNA expression revealed that periapical granulomas expressed significantly more MK than healthy gingival tissues. These findings suggest that MK is involved in the pathogenesis of periapical granulomas.
21233844 selective targeting of the Mdk/ALK axis could help to improve the efficacy of antitumoral therapies for gliomas.
21212259 Premature ligand-receptor interaction during biosynthesis limits the production of growth factor midkine and its receptor LDL receptor-related protein 1.
21208277 The level of midkine expression in breast cancer significantly correlated with lymph node metastasis (p = 0.001) and TNM staging (p = 0.003).
21094842 Midkine levels are dependent on heart and kidney function, and might also represent a surrogate marker of subclinical inflammation in heart transplant recipients.
20811700 Midkine (MK) expression may affect prognosis via the p53 status and mutation of the p53 gene, and MK may be an attractive target for therapeutic intervention in patients with cancer cells with mutant p53.
20589434 Increased Serum Midkine Concentrations Correlate with Recurrence and Decreased Serum Midkine Level Correlates with Imatinib therapy in gastrointestinal stromal tumors.
20544404 there was powerful drug efflux ability in lymphoblastic leukemia cells with high MK gene expression. MK gene may take part in multidrug resistance.
20525245 High serum midkine is associated with ovarian cancer.
20511550 Because of its wide expression in cancer tissues and its contribution to tumorigenesis, secreted MDK appears to be a novel attractive candidate for a cancer vaccine.
20447063 Recombinant human MDK stimulates proliferation of articular chondrocytes.
20442752 Midkine promotes self-renewal and proliferation of human embryonic stem cells.
20350697 Serum midkine is a novel, reliable marker for risk-stratifying of heart failure patients with left ventricular systolic or diastolic dysfunction.
20308059 Midkine and pleiotrophin have bactericidal properties: preserved antibacterial activity in a family of heparin-binding growth factors during evolution.
20030935 There is powerful drug efflux ability in lymphoblastic leukemia cells with high midkine gene expression.
20030927 High expression of MK and VEGF in bone marrow is correlated with angiogenesis and prognosis of multiple myeloma.
19728850 ulcerative colitis is associated with increased circulating midkine, which corresponds with clinical, endoscopic, inflammatory and angiogenic activity, and anemia.
19698107 The angiogenic factor midkine is regulated by dexamethasone and retinoic acid during alveolarization and in alveolar epithelial cells.
19538527 High plasma midkine is associated with breast cancer.
19409372 These results indicate that MK might be involved in the pathogenesis of leukemia and could be taken as an ideal diagnostic marker and molecular target for the treatment of acute leukemia.
19250738 MDK contributes to gastric cancer cell proliferation and suggest that it plays an important role in the development of human gastric cancer.
19112919 MK gene expression is increased with different levels in B-ALL patients.
19060126 Midkine prevents ventricular remodeling and improves long-term survival after myocardial infarction.
19016768 Plasma MDK level is a prognostic factor for human neuroblastoma.
18985819 Midkine accumulated in nucleolus of HepG2 cells involved in rRNA transcription.
18956201 midkine-mRNA expression was found in the majority of the neuroblastoma tissues. No correlation of MK status with survival, risk factors or disease stage was observed.
18851943 The major finding of this study is a novel MK-triggered signaling mechanism implicated in migration and invasiveness of head and neck squamous cell carcinoma cells.
18712601 Quantitative analysis of MK mRNA may be a promising modality for the diagnosis of pancreatic cancer and the prediction of its prognosis.
18698021 midkine enhances soft-tissue sarcoma tumor growth
18682710 Increased serum midkine is associated with oral squamous cell carcinoma.
18657127 increased expression in the prefrontal cortex of chronic alcoholics
18476626 Both TP and MK are important for angiogenesis in laryngeal squamous cell carcinoma. The expression of TP, MK and CD105 were all correlated with T-stage and lymph node metastasis.
18469519 Midkine induces epithelial-mesenchymal transition through Notch2/Jak2-Stat3 signaling in human keratinocytes.
18422745 higher serum MK protein concentration was correlated with the presence of lymph node metastases and prognosis of endometrial carcinomas
18329695 MK is considered to mediate growth activity of odontogenic tumors and cell differentiation of odontogenic mixed tumors through molecular mechanisms similar to those involved in morphogenesis of the tooth.
18195496 Midkine was expressed in choroid plexus of normal brain and released there; CSF MK levels were not high in patients with cerebral infarction but were increased in patients with meningitis
18176965 Midkine has anti-apoptotic and cytoprotective role during cadmium toxicity in hepatocytes
17971413 These data demonstrate a crucial role of MK-LRP1 signaling in anchorage-independent cell growth.
17931612 IL-6 and IL-8, and probably midkine and VEGF-A, appear to participate in the development of cancer-related cachexia in gastroesophageal malignancies.
17845207 MK is involved in granulosa cell proliferation and estradiol production in developing follicles and may play a role as a local regulator in the human ovary.
17607302 Midkine expression was detected in the glomeruli, tubular epithelium and interstitium of kidneys from patients with diabetic nephropathy
17493173 MK expression was increased along with tumor progression.
17451201 Antisense oligonucleotide targeting midkine suppressed the angiogenesis both in human hepatocellular carcinoma cell line (HEPG2)-induced chick chorioallantoic membrane and in situ human HCC tissues.
17368428 Midkine, pleiotrophin (PTN), and their receptors syndecan-3 and receptor protein tyrosine phosphatase beta/zeta, were highly expressed in the striatum during developmen
17267033 Overexpression of midkine is associated with childhood B-precursor acute lymphoblastic leukemia
17171794 localized exclusively to the nucleus and accumulated in the nucleolus in the three kinds of cancer cell lines
17066487 Resultsd suggested that truncated MK (tMK) has a greater ability of malignant transformation than full-length MK, and whether tMK is expressed or not will be useful information for improving cancer chemotherapy.
16895951 Midkine likely plays a key role in human fetal adrenal glandcdevelopment.
15897897 A survival molecule, midkine, was identified by cDNA array to be expressed only in drug-resistant neuroblastoma cells.
15781266 reported that human MK exclusively localized to the nucleus and nucleolus in HepG2 cells by using GFP as a tracking molecule
15734764 MK may play roles, such as stimulation of endometriotic cell proliferation, in the development of endometriosis.
15355893 Increased midkine levels are associated with tumorigenesis in neurofibromatosis type 1
15201962 Midkine promoter-based conditionally replicative adenovirus might be a promising new modality of gene therapy for malignant glioma.
15146411 MK participates in each of the two distinct phases of rheumatoid arthritis development, namely, migration of inflammatory leukocytes and osteoclast differentiation, and is a key molecule in pathogenesis
15138367 data showed that the midkine promoter activated a therapeutic gene in a wider range of human breast cancer than the c-erbB-2 promoter and suggest that MK promoter-mediated gene therapy is potentially more favorable in clinical settings
15050737 a G to T substitution at the 62nd site of intron 3 in the midkine gene enhances the expression of truncated midkine in colon cancer
14970216 nuclear targeting growth factor midkine undergoes proteasomal degradation
12841873 Increased preoperative serum midkine in patients with esophageal squamous cell carcinoma is associated with poor survival.
12579281 Increased midkine expression is associated with superficial esophageal cancer
12175547 Observational study of gene-disease association. (HuGE Navigator)
12147681 results suggest that the cell surface-expressed nucleolin serves as a low affinity receptor for midkine and could be implicated in its entry process
12127679 Midkine is expressed in astrocytes during the early period of human brain ischemia.
12122009 midkine binds to ALK and has a role in signal transduction for cell growth and survival
12077357 In a blood vessel model, midkine induced stratification of endothelial cells and increased their proliferation and glycosaminoglycan synthesis. Increased proliferation of endothelium also occurred by coculture with smooth muscle cells and midkine.
11925507 Requirement of chondroitin sulfate/dermatan sulfate recognition in midkine-dependent migration of macrophages

AA Sequence

MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC      1 - 70
RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK     71 - 140
GKD                                                                       141 - 143
//

Text Mined References (137)

PMID Year Title
27089523 2016 Midkine and Pleiotrophin Concentrations in Amniotic Fluid in Healthy and Complicated Pregnancies.
26656665 2015 MDK Protein Overexpression Correlates with the Malignant Status and Prognosis of Non-small Cell Lung Cancer.
26642712 2015 Phospholipid Scramblase 1 Interacts with Midkine and Regulates Hepatic Cancer Cell Proliferation and Migration.
26566633 2016 Midkine in vitamin D deficiency and its association with anti-Saccharomyces cerevisiae antibodies.
26297257 2015 Strong immunoexpression of midkine is associated with multiple lymph node metastases in BRAFV600E papillary thyroid carcinoma.
26159850 2015 The clinical and prognostic significance of midkine in breast cancer patients.
25817231 2015 Evaluation of serum midkine as a biomarker in differentiated thyroid cancer.
25787827 2015 The Circulating Levels of Selenium, Zinc, Midkine, Some Inflammatory Cytokines, and Angiogenic Factors in Mitral Chordae Tendineae Rupture.
25655295 2015 Development of hybrid-type modified chitosan derivative nanoparticles for the intracellular delivery of midkine-siRNA in hepatocellular carcinoma cells.
25428991 2015 Transcriptional factor specificity protein 1 (SP1) promotes the proliferation of glioma cells by up-regulating midkine (MDK).
25355294 2015 The mutational landscape in pediatric acute lymphoblastic leukemia deciphered by whole genome sequencing.
25283079 2014 Immunohistochemical evaluation of midkine and nuclear factor-kappa B as diagnostic biomarkers for papillary thyroid cancer and synchronous metastasis.
25056169 2014 Serum levels for midkine, a heparin-binding growth factor, inversely correlate with angiotensin and endothelin receptor autoantibody titers in patients with macroangiopathy.
25017879 2014 Midkine and syndecan?1 levels correlate with the progression of malignant gastric cardiac adenocarcinoma.
25001988 2014 Co-expression of midkine and pleiotrophin predicts poor survival in human glioma.
24659893 2014 Midkine promotes perineural invasion in human pancreatic cancer.
24567526 2014 The multifunctional growth factor midkine promotes proliferation and migration in pancreatic cancer.
24516630 2014 Midkine, a potential link between obesity and insulin resistance.
24500281 2014 PKC?/midkine pathway drives hypoxia-induced proliferation and differentiation of human lung epithelial cells.
24272599 2014 Midkine expression is associated with clinicopathological features and BRAF mutation in papillary thyroid cancer.
24164595 2013 Midkine neurite growth-promoting factor 2 expression as a potential prognostic marker of adjuvant therapy in head and neck squamous cell carcinoma.
24043271 2013 Midkine is expressed and differentially processed during chronic obstructive pulmonary disease exacerbations and ventilator-associated pneumonia associated with Staphylococcus aureus infection.
23899719 2013 Circulating midkine in malignant and non-malignant colorectal diseases.
23815177 2013 High expression of midkine in the airways of patients with cystic fibrosis.
23719264 2013 Evaluation of midkine as a diagnostic serum biomarker in hepatocellular carcinoma.
23553629 2013 The signal peptide of the tumor-shared antigen midkine hosts CD4+ T cell epitopes.
23391998 2013 Midkine is part of the antibacterial activity released at the surface of differentiated bronchial epithelial cells.
23243020 2013 Midkine promotes neuroblastoma through Notch2 signaling.
23224432 2013 Midkine mRNA level in peripheral blood mononuclear cells is a novel biomarker for primary non-small cell lung cancer: a prospective study.
23212314 2013 Diagnostic and predictive role of cell-free midkine in malignant pleural effusions.
23129424 2013 Midkine is associated with neuroendocrine differentiation in castration-resistant prostate cancer.
22871361 2012 Recombinant expression and purification of heparin binding proteins: midkine and pleiotrophin from Escherichia coli.
22707563 2012 Midkine acts as proangiogenic cytokine in hypoxia-induced angiogenesis.
22672821 2012 Novel functional proteins interact with midkine in hepatic cancer cells.
22669742 2012 ER?-mediated estradiol enhances epithelial mesenchymal transition of lung adenocarcinoma through increasing transcription of midkine.
22562257 2012 Tumor location determines midkine level and its association with the disease progression in colorectal cancer patients: a pilot study.
22417224 2012 Plasma levels of midkine (neurite growth-promoting factor 2) are not associated with plasma fibrinolytic potential or risk of venous thrombosis.
22415659 2012 Midkine upregulates MICA/B expression in human gastric cancer cells and decreases natural killer cell cytotoxicity.
22249249 2012 Candidate DNA methylation drivers of acquired cisplatin resistance in ovarian cancer identified by methylome and expression profiling.
22099874 2012 Therapeutic approaches targeting midkine suppress tumor growth and lung metastasis in osteosarcoma.
22051879 2012 Expression of midkine and vascular endothelial growth factor in gastric cancer and the association of high levels with poor prognosis and survival.
21989914 2011 Midkine and Alk signaling in sympathetic neuron proliferation and neuroblastoma predisposition.
21917682 2011 Serum midkine as a prognostic biomarker for patients with hepatocellular carcinoma.
21826666 2011 Increased midkine expression correlates with desmoid tumour recurrence: a potential biomarker and therapeutic target.
21787488 2011 Midkine expression in human periapical granulomas.
21233844 2011 Stimulation of the midkine/ALK axis renders glioma cells resistant to cannabinoid antitumoral action.
21212259 2011 Premature ligand-receptor interaction during biosynthesis limits the production of growth factor midkine and its receptor LDL receptor-related protein 1.
21208277 2011 Expression of midkine and endoglin in breast carcinomas with different immunohistochemical profiles.
21094842 2010 Serum midkine is related to NYHA class and cystatin C in heart transplant recipients.
20811700 2010 Midkine expression is correlated with an adverse prognosis and is down-regulated by p53 in oral squamous cell carcinoma.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20589434 2011 Serum midkine correlates with tumor progression and imatinib response in gastrointestinal stromal tumors.
20544404 2010 Increased drug efflux along with midkine gene high expression in childhood B-lineage acute lymphoblastic leukemia cells.
20525245 2010 Evaluation of midkine and anterior gradient 2 in a multimarker panel for the detection of ovarian cancer.
20511550 2010 The angiogenic growth factor and biomarker midkine is a tumor-shared antigen.
20447063 2010 Recombinant human midkine stimulates proliferation of articular chondrocytes.
20442752 2010 Promotion of self-renewal of embryonic stem cells by midkine.
20431264 2010 Midkine, a heparin-binding cytokine with multiple roles in development, repair and diseases.
20350697 2010 Serum midkine as a predictor of cardiac events in patients with chronic heart failure.
20308059 2010 Midkine and pleiotrophin have bactericidal properties: preserved antibacterial activity in a family of heparin-binding growth factors during evolution.
20030935 2009 [Relationship between midkine expression and drug efflux in childhood acute lymphoblastic leukemia cells].
20030927 2009 [Expression of midkine and vascular endothelial growth factor in bone marrow of patients with multiple myeloma and its significance].
19728850 2009 Clinical relevance of circulating midkine in ulcerative colitis.
19698107 2009 The angiogenic factor midkine is regulated by dexamethasone and retinoic acid during alveolarization and in alveolar epithelial cells.
19538527 2009 Midkine in plasma as a novel breast cancer marker.
19409372 2009 Overexpression of Midkine promotes the viability of BA/F3 cells.
19250738 2009 Midkine positively regulates the proliferation of human gastric cancer cells.
19112919 2008 [The expression of midkine in acute leukemia and its significance].
19060126 2009 Midkine prevents ventricular remodeling and improves long-term survival after myocardial infarction.
19016768 2008 Plasma midkine level is a prognostic factor for human neuroblastoma.
18985819 2008 Midkine accumulated in nucleolus of HepG2 cells involved in rRNA transcription.
18956201 2008 Midkine is highly expressed in neuroblastoma tissues.
18851943 2008 Midkine promotes tetraspanin-integrin interaction and induces FAK-Stat1alpha pathway contributing to migration/invasiveness of human head and neck squamous cell carcinoma cells.
18712601 2009 Midkine mRNA is overexpressed in pancreatic cancer.
18698021 2008 Midkine enhances soft-tissue sarcoma growth: a possible novel therapeutic target.
18682710 2008 Midkine as a prognostic biomarker in oral squamous cell carcinoma.
18657127 2008 Impact of alcohol abuse on protein expression of midkine and excitatory amino acid transporter 1 in the human prefrontal cortex.
18476626 2008 [The expressions of TP, MK and CD105 in laryngeal squamous cell carcinoma and their clinical significance].
18469519 2008 Midkine induces epithelial-mesenchymal transition through Notch2/Jak2-Stat3 signaling in human keratinocytes.
18422745 2008 Midkine and its clinical significance in endometrial carcinoma.
18329695 2008 Midkine expression correlating with growth activity and tooth morphogenesis in odontogenic tumors.
18195496 2008 Expression of the heparin-binding growth factor midkine in the cerebrospinal fluid of patients with neurological disorders.
18176965 2008 Midkine secretion protects Hep3B cells from cadmium induced cellular damage.
17971413 2007 Midkine and LDL-receptor-related protein 1 contribute to the anchorage-independent cell growth of cancer cells.
17931612 2007 Impact of weight loss on circulating IL-1, IL-6, IL-8, TNF-alpha, VEGF-A, VEGF-C and midkine in gastroesophageal cancer patients.
17845207 2007 The presence of midkine and its possible implication in human ovarian follicles.
17607302 2007 Midkine is involved in tubulointerstitial inflammation associated with diabetic nephropathy.
17493173 2007 Midkine expression in colorectal tumors: correlation with Ki-67 labeling in sporadic, but not ulcerative colitis-associated ones.
17451201 2007 Antisense oligonucleotide targeting midkine suppresses in vivo angiogenesis.
17379400 2007 Abnormal expression, highly efficient detection and novel truncations of midkine in human tumors, cancers and cell lines.
17368428 2007 Role of heparin binding growth factors in nigrostriatal dopamine system development and Parkinson's disease.
17267033 2007 Increased midkine gene expression in childhood B-precursor acute lymphoblastic leukemia.
17171794 2006 Construction of a fusion protein expression vector MK-EGFP and its subcellular localization in different carcinoma cell lines.
17066487 Truncated midkine correlates with sensitivity to anticancer drugs and malignancy in human tumor cell line.
16895951 2006 Midkine, a heparin-binding growth factor, selectively stimulates proliferation of definitive zone cells of the human fetal adrenal gland.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15897897 2005 Identification of midkine as a mediator for intercellular transfer of drug resistance.
15781266 2005 Conformational determinants of the intracellular localization of midkine.
15734764 2005 Possible implication of midkine in the development of endometriosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355893 2004 Circulating growth factor levels are associated with tumorigenesis in neurofibromatosis type 1.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15201962 2004 Midkine promoter-based conditionally replicative adenovirus for malignant glioma therapy.
15197188 2004 Midkine is regulated by hypoxia and causes pulmonary vascular remodeling.
15146411 2004 Midkine, a heparin-binding growth factor, is fundamentally involved in the pathogenesis of rheumatoid arthritis.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15138367 2004 Midkine promoter can mediate transcriptional activation of a fused suicide gene in a broader range of human breast cancer compared with c-erbB-2 promoter.
15050737 2004 Exon skipping of midkine pre-mRNA is enhanced by intronic polymorphism in a colon cancer cell line.
14970216 2004 Proteasomal degradation of the nuclear targeting growth factor midkine.
14517843 2003 Quantitative RT-PCR in cirrhotic nodules reveals gene expression changes associated with liver carcinogenesis.
12841873 2003 Preoperative serum midkine concentration is a prognostic marker for esophageal squamous cell carcinoma.
12579281 Increased serum midkine concentration as a possible tumor marker in patients with superficial esophageal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175547 2002 Association of an intronic polymorphism in the midkine (MK) gene with human sporadic colorectal cancer.
12147681 2002 The anti-HIV cytokine midkine binds the cell surface-expressed nucleolin as a low affinity receptor.
12127679 2002 Alteration of midkine expression in the ischemic brain of humans.
12122009 2002 Midkine binds to anaplastic lymphoma kinase (ALK) and acts as a growth factor for different cell types.
12077357 2002 Midkine, a heparin-binding growth factor, promotes growth and glycosaminoglycan synthesis of endothelial cells through its action on smooth muscle cells in an artificial blood vessel model.
11048798 2000 Immunohistochemical and in situ hybridization analyses of midkine expression in thyroid papillary carcinoma.
10772929 2000 LDL receptor-related protein as a component of the midkine receptor.
10212223 1999 A receptor-like protein-tyrosine phosphatase PTPzeta/RPTPbeta binds a heparin-binding growth factor midkine. Involvement of arginine 78 of midkine in the high affinity binding to PTPzeta.
9452495 1998 Midkine induces tumor cell proliferation and binds to a high affinity signaling receptor associated with JAK tyrosine kinases.
9384573 1997 Solution structure of midkine, a new heparin-binding growth factor.
9089390 1997 Expression of syndecan-1 and -3 during embryogenesis of the central nervous system in relation to binding with midkine.
8694802 1996 Transglutaminase forms midkine homodimers in cerebellar neurons and modulates the neurite-outgrowth response.
8621465 1996 Human ryudocan from endothelium-like cells binds basic fibroblast growth factor, midkine, and tissue factor pathway inhibitor.
8471163 1993 Structure of the gene coding for the human retinoic acid-inducible factor, MK.
8406506 1993 Midkine gene (MDK), a gene for prenatal differentiation and neuroregulation, maps to band 11p11.2 by fluorescence in situ hybridization.
8241100 1993 Identification of novel heparin-releasable proteins, as well as the cytokines midkine and pleiotrophin, in human postheparin plasma.
7835084 1995 Chromosomal assignment of the heparin-binding cytokine genes MDK and PTN in mouse and man.
2025291 1991 A new family of heparin-binding factors: strong conservation of midkine (MK) sequences between the human and the mouse.
1883381 1991 Amphiregulin-associated protein: complete amino acid sequence of a protein produced by the 12-0-tetradecanoylphorbol-13-acetate-treated human breast adenocarcinoma cell line MCF-7.
1768439 1991 Cloning, characterization and developmental regulation of two members of a novel human gene family of neurite outgrowth-promoting proteins.
1701366 1990 Evidence that the B2 chain of laminin is responsible for the neurite outgrowth-promoting activity of astrocyte extracellular matrix.
1639750 1992 Genomic structure of human midkine (MK), a retinoic acid-responsive growth/differentiation factor.