Property Summary

NCBI Gene PubMed Count 40
PubMed Score 180.24
PubTator Score 86.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.000 4.1e-03
astrocytic glioma -1.400 1.1e-02
ependymoma -1.300 3.8e-02
oligodendroglioma -1.100 3.9e-02
psoriasis 1.100 4.7e-04
glioblastoma 1.300 2.9e-02
atypical teratoid / rhabdoid tumor -1.200 5.4e-05
medulloblastoma -1.100 3.6e-05
pancreatic ductal adenocarcinoma liver m... -1.693 3.2e-02
lung cancer 1.600 9.7e-05
Breast cancer 2.600 2.5e-02
Pick disease -1.100 2.7e-03
ovarian cancer 2.700 3.6e-06

Gene RIF (7)

PMID Text
25766404 Segregation of the mutation with disease and absence of MDH2 in mutated tumors revealed MDH2 as a novel pheochromocytoma/paraganglioma susceptibility gene.
25639359 Data indicate that acetyl-CoA acetyltransferase (ACAT1) and malate dehydrogenase (MDH2) are involved in various drug-resistance-forming mechanisms.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of malate dehydrogenase 2 (MDH2) expression by HIV-1 Vpr in Vpr transduced macrophages
22944692 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of malate dehydrogenase 2 (MDH2) expression by HIV-1 Vpr in Vpr transduced macrophages
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17603759 L-2-hydroxyglutarate accumulates as a result of a deficiency in FAD-linked L-2-hydroxyglutarate dehydrogenase. mitochondrial L-malate dehydrogenase is responsible for the excretion of L-2-hydroxyglutarate in this condition.

AA Sequence

MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSH      1 - 70
IETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVI     71 - 140
ANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLIS    141 - 210
QCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKS    211 - 280
QETECTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK                281 - 338
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25766404 2015 Whole-exome sequencing identifies MDH2 as a new familial paraganglioma gene.
25639359 2015 Mitochondrial proteomics with siRNA knockdown to reveal ACAT1 and MDH2 in the development of doxorubicin-resistant uterine cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20167786 2010 Regulation of cellular metabolism by protein lysine acetylation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17603759 2007 L-2-hydroxyglutaric aciduria, a defect of metabolite repair.
16751257 2006 Housekeeping genes for phylogenetic analysis of eutherian relationships.
16740313 2006 An NADH-tetrazolium-coupled sensitive assay for malate dehydrogenase in mitochondria and crude tissue homogenates.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11029287 2000 Tom20-mediated mitochondrial protein import in muscle cells during differentiation.
10075524 1999 Structural basis of substrate specificity in malate dehydrogenases: crystal structure of a ternary complex of porcine cytoplasmic malate dehydrogenase, alpha-ketomalonate and tetrahydoNAD.
9792662 1998 Interaction between citrate synthase and malate dehydrogenase. Substrate channeling of oxaloacetate.
9792106 1998 Aggregation states of mitochondrial malate dehydrogenase.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.
8349677 1993 Interactions between pyruvate carboxylase and other mitochondrial enzymes.
7698769 1994 Mor2, supernatant malate dehydrogenase, is linked to wa2 and Hba on mouse chromosome 11 in a region of homology with human chromosome 2p.
7285903 1981 Demonstration of physical interactions between consecutive enzymes of the citric acid cycle and of the aspartate-malate shuttle. A study involving fumarase, malate dehydrogenase, citrate synthesis and aspartate aminotransferase.
6576816 1983 Studies on mitochondrial and cytoplasmic malate dehydrogenase in childhood myelodysplastic syndrome.
6439716 1984 Complex I binds several mitochondrial NAD-coupled dehydrogenases.
3591372 1987 Enzyme levels of the NADH shuttle systems: measurements in isolated muscle fibres from humans of differing physical activity.
2899080 1988 Regulation of malate dehydrogenase activity by glutamate, citrate, alpha-ketoglutarate, and multienzyme interaction.
2759092 1989 The visualization by affinity electrophoresis of a specific association between the consecutive citric acid cycle enzymes fumarase and malate dehydrogenase.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1505215 1992 Sublocalization of an invasion-inducing locus and other genes on human chromosome 7.
606506 1977 Assignment of the genes for human beta-glucuronidase and mitochondrial malate dehydrogenase to the region pter leads to q22 of chromosome 7.