Property Summary

NCBI Gene PubMed Count 31
PubMed Score 409.59
PubTator Score 108.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.161 9.0e-03
Multiple myeloma 1.637 6.5e-04
astrocytic glioma -2.000 1.8e-03
ependymoma -1.800 4.3e-03
oligodendroglioma -1.500 2.0e-02
psoriasis 1.600 4.8e-05
glioblastoma -1.500 9.9e-06
osteosarcoma 1.389 7.9e-04
medulloblastoma -1.600 1.8e-08
atypical teratoid / rhabdoid tumor -1.600 3.2e-08
medulloblastoma, large-cell -1.200 1.7e-04
primitive neuroectodermal tumor -1.200 9.4e-05
adrenocortical carcinoma 1.436 6.2e-06
pancreatic ductal adenocarcinoma liver m... -1.536 2.3e-02
intraductal papillary-mucinous adenoma (... 1.200 1.9e-03
intraductal papillary-mucinous carcinoma... 1.200 2.5e-03
Parkinson's disease -1.300 4.6e-02
Breast cancer 2.400 2.8e-02
adult high grade glioma -1.600 6.9e-06
pilocytic astrocytoma -1.100 7.6e-07
Alzheimer's disease -1.300 4.0e-02
Pick disease -1.900 7.5e-04
ovarian cancer 3.000 2.6e-06

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
22693256 adipogenic differentiation may be regulated by the acetylation of MDH1
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20011630 The MDH1 gene is not the cause of RP28-linked autosomal recessive retinitis pigmentosa.
19229245 Malate Dehydrogenase directly regulates the Tumor Suppressor Protein p53-dependent apoptosis upon glucose deprivation and involved in maintaining cellular metabolic state and further determining cell death.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15565635 expression of MDH1 is maintained in the adult heart but is not present in levels as high as in the fetus

AA Sequence

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIA      1 - 70
TDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTA     71 - 140
SKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY    141 - 210
EALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGV    211 - 280
PDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA                    281 - 334
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25340584 2014 Ribosomal readthrough at a short UGA stop codon context triggers dual localization of metabolic enzymes in Fungi and animals.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22693256 2012 Acetylation of malate dehydrogenase 1 promotes adipogenic differentiation via activating its enzymatic activity.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20011630 2009 Ultra high throughput sequencing excludes MDH1 as candidate gene for RP28-linked retinitis pigmentosa.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19229245 2009 A nucleocytoplasmic malate dehydrogenase regulates p53 transcriptional activity in response to metabolic stress.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16139798 2005 Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15565635 2005 Developmental regulation and cellular distribution of human cytosolic malate dehydrogenase (MDH1).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11726686 2001 Misreading of termination codons in eukaryotes by natural nonsense suppressor tRNAs.
10190973 1999 Ability of cytosolic malate dehydrogenase and lactate dehydrogenase to increase the ratio of NADPH to NADH oxidation by cytosolic glycerol-3-phosphate dehydrogenase.
10075524 1999 Structural basis of substrate specificity in malate dehydrogenases: crystal structure of a ternary complex of porcine cytoplasmic malate dehydrogenase, alpha-ketomalonate and tetrahydoNAD.
9799840 1998 Homology between human chromosome 2p13.3 and the wobbler critical region on mouse chromosome 11: comparative high-resolution mapping of STS and EST loci on YAC/BAC contigs.
8786100 1996 Molecular cloning and mapping of a human cDNA for cytosolic malate dehydrogenase (MDH1).
7895732 1994 The human myocardial two-dimensional gel protein database: update 1994.
7698769 1994 Mor2, supernatant malate dehydrogenase, is linked to wa2 and Hba on mouse chromosome 11 in a region of homology with human chromosome 2p.
7151307 1982 Further evidence by gene dosage for the regional assignment of erythrocyte acid phosphatase (ACP1) and malate dehydrogenase (MDH1) loci on chromosome 2p.
3052244 1988 Biochemical and genetic identity of alpha-keto acid reductase and cytoplasmic malate dehydrogenase from human erythrocytes.
2775751 1989 Refined crystal structure of cytoplasmic malate dehydrogenase at 2.5-A resolution.
2449162 1987 The reduction of aromatic alpha-keto acids by cytoplasmic malate dehydrogenase and lactate dehydrogenase.