Property Summary

NCBI Gene PubMed Count 25
PubMed Score 10.75
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Gene RIF (12)

PMID Text
21660437 Polymorphisms of rs961616 in MAMDC1 gene were associated with rash and photosensitivity, but not disease risk, of systemic lupus erythematosus in Chinese population.
21542908 This study demonistrated suggested taht Rostral growth of commissural axons requires the cell adhesion molecule MDGA2
21399569 This finding provides further support for a link between variants in the MDGA2 gene and specific neuroticism-related phenotypes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19997561 A novel uncharacterized gene, MAMDC1 (MAM domain containing glycosylphosphatidylinositol anchor 2, also known as MDGA2, MIM 611128), represents a putative susceptibility gene for systemic lupus erythematosus.
19997561 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19557195 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19440164 No association of rs7151262 with neuroticism was found
18762592 MAMDC1 gene is implicated in neuroticism.
18762592 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDLLYGLVWLLTVLLEGISGQGVYAPPTVRIVHSGLACNIEEERYSERVYTIREGETLELTCLVTGHPRP      1 - 70
QIRWTKTAGSASDRFQDSSVFNETLRITNIQRHQGGRYYCKAENGLGSPAIKSIRVDVYYLDDPVVTVHQ     71 - 140
SIGEAKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQGSDKGVEIYEPFFTQGETKILKLKNLRPQD    141 - 210
YANYSCIASVRNVCNIPDKMVSFRLSNKTASPSIKLLVDDPIVVNPGEAITLVCVTTGGEPAPSLTWVRS    211 - 280
FGTLPEKTVLNGGTLTIPAITSDDAGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYHKDDNIQ    281 - 350
IGREVKISCQVEAVPSEELTFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVAS    351 - 420
LKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSRADKEVAMPDGS    421 - 490
MQMESYDGTLRIVNVSREMSGMYRCQTSQYNGFNVKPREALVQLIVQYPPAVEPAFLEIRQGQDRSVTMS    491 - 560
CRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKA    561 - 630
YAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGELI    631 - 700
TYNLTELIKPEAYEVRLTPLTKFGEGDSTIRVIKYSAPVNPHLREFHCGFEDGNICLFTQDDTDNFDWTK    701 - 770
QSTATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSIAPKNPYGPTNTAYCFSFF    771 - 840
YHMYGQHIGVLNVYLRLKGQTTIENPLWSSSGNKGQRWNEAHVNIYPITSFQLIFEGIRGPGIEGDIAID    841 - 910
DVSIAEGECAKQDLATKNSVDGAVGILVHIWLFPIIVLISILSPRR                            911 - 956
//

Text Mined References (25)

PMID Year Title
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23358245 2013 Interaction between autism-linked MDGAs and neuroligins suppresses inhibitory synapse development.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
22445761 2012 Genome-wide association study of SSRI/SNRI-induced sexual dysfunction in a Japanese cohort with major depression.
21660437 2011 Single-nucleotide polymorphisms of MAMDC1 are associated with rash and photosensitivity, but not disease risk, of systemic lupus erythematosus in Chinese mainland population.
21542908 2011 Rostral growth of commissural axons requires the cell adhesion molecule MDGA2.
21399569 2011 Evidence for associations between MDGA2 polymorphisms and harm avoidance: replication and extension of a genome-wide association finding.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19997561 2009 Identification of MAMDC1 as a candidate susceptibility gene for systemic lupus erythematosus (SLE).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19557195 2009 Genome-wide analyses of exonic copy number variants in a family-based study point to novel autism susceptibility genes.
19440164 2009 Follow-up association study of novel neuroticism gene MAMDC1.
18762592 2008 Genomewide association analysis followed by a replication study implicates a novel candidate gene for neuroticism.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15019943 2004 Identification and characterization of two novel brain-derived immunoglobulin superfamily members with a unique structural organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.