Property Summary

NCBI Gene PubMed Count 18
PubMed Score 601.89
PubTator Score 68.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
chronic lymphocytic leukemia 1.133 1.5e-02
Multiple myeloma 1.125 2.4e-02
malignant mesothelioma -2.300 7.5e-06
glioblastoma 1.500 1.1e-03
posterior fossa group B ependymoma 2.300 2.9e-09
astrocytoma 1.900 2.5e-02
hereditary spastic paraplegia -1.086 1.4e-03
primary pancreatic ductal adenocarcinoma 1.021 5.1e-03
intraductal papillary-mucinous carcinoma... -2.500 3.9e-03
lung cancer 1.200 5.6e-03
active ulcerative colitis -2.587 1.3e-02
sarcoidosis 1.100 1.5e-02
pediatric high grade glioma 1.500 1.3e-03
sonic hedgehog group medulloblastoma 2.200 5.5e-05
primary Sjogren syndrome 1.200 2.4e-02
aldosterone-producing adenoma -1.609 8.0e-03
spina bifida -2.681 4.9e-02
Breast cancer -1.100 5.4e-04
ductal carcinoma in situ -1.700 5.1e-03
invasive ductal carcinoma -2.200 1.3e-02
ovarian cancer -3.700 1.0e-07
pituitary cancer -1.700 1.1e-05
pancreatic cancer 1.100 3.8e-03

Gene RIF (12)

PMID Text
26469549 HIC specifically interacts with HTLV-1 Tax and negatively regulates Tax transactivational activity by altering its subcellular distribution and stability.
21401918 We demonstrate that HIC selectively interferes with Rev NLS interaction with importin beta and impedes its nuclear import and function, but does not affect Rev nuclear import mediated by transportin.
21401918 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
20417616 These data reveal for the first time that I-mfa domain proteins interact with LANA and negatively regulate LANA-mediated activation of Wnt signaling-dependent transcription by inhibiting the formation of the LANA.GSK-3beta complex.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19582149 strict regulation of HIC expression at the levels of mRNA stability, translation efficiency and protein stability suggests that expression of the HIC protein and its involvement in the various pathways is required only under specific cellular conditions
19428567 This study describes that the immune expression of HIC is cell-specific, dynamic, and identifies the HIC gene as an IL-2 responsive gene.
17289077 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
16260749 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
12944466 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
10671520 Two isoforms, resulting from the use of a non-AUG (GUG) and a downstream in-frame AUG translation initiation codon, have different subcellular localization.
10671520 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner

AA Sequence

MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGEL      1 - 70
IRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLS     71 - 140
VNSDISKKSKVNAVFSQKTGSSPEDCCVHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGD    141 - 210
DCNCPCDMDCGIMDACCESSDCLEICMECCGICFPS                                      211 - 246
//

Text Mined References (20)

PMID Year Title
26469549 2015 I-mfa domain proteins specifically interact with HTLV-1 Tax and repress its transactivating functions.
23818313 2013 Combined linkage and association analyses identify a novel locus for obesity near PROX1 in Asians.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21401918 2011 Intermolecular masking of the HIV-1 Rev NLS by the cellular protein HIC: novel insights into the regulation of Rev nuclear import.
20417616 2010 Human I-mfa domain proteins specifically interact with KSHV LANA and affect its regulation of Wnt signaling-dependent transcription.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19582149 2009 The complex regulation of HIC (Human I-mfa domain containing protein) expression.
19428567 2009 Expression profile and differential regulation of the Human I-mfa domain-Containing protein (HIC) gene in immune cells.
19041912 2009 The 3'UTR of HIC mRNA improves the production of recombinant proteins in Chinese hamster ovary cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17289077 2007 Developmental regulators containing the I-mfa domain interact with T cyclins and Tat and modulate transcription.
17064770 2007 HIC gene, a candidate suppressor gene within a minimal region of loss at 7q31.1 in myeloid neoplasms.
16260749 2005 Direct interaction of the human I-mfa domain-containing protein, HIC, with HIV-1 Tat results in cytoplasmic sequestration and control of Tat activity.
12944466 2003 The human I-mfa domain-containing protein, HIC, interacts with cyclin T1 and modulates P-TEFb-dependent transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370022 2001 How the sequestration of a protein interferes with its mechanism of action: example of a new family of proteins characterized by a particular cysteine-rich carboxy-terminal domain involved in gene expression regulation.
12192039 2002 I-mfa domain proteins interact with Axin and affect its regulation of the Wnt and c-Jun N-terminal kinase signaling pathways.
11139147 2000 Sequence requirement for the nucleolar localization of human I-mfa domain-containing protein (HIC p40).
10671520 2000 Molecular cloning of a novel human I-mfa domain-containing protein that differently regulates human T-cell leukemia virus type I and HIV-1 expression.