Property Summary

NCBI Gene PubMed Count 21
PubMed Score 44.17
PubTator Score 30.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.1e-54
pilocytic astrocytoma 3086 1.3e-04
cutaneous lupus erythematosus 1056 2.8e-02
Disease Target Count Z-score Confidence
Mycosis fungoides 30 3.68 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 2.8e-02
pilocytic astrocytoma 1.200 1.3e-04
psoriasis 1.700 3.1e-54

Synonym

Accession Q99750
Symbols I-MF
I-mfa

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
22632162 HIV-1 Tat 47-59 peptide downregulates gene expression of MyoD family inhibitor (MDFI) in U-937 macrophages
21664411 I-mfa domain proteins may be involved in their oncogenic functions by negatively regulating their transcriptional activities.
17289077 HIV-1 Tat 47-59 peptide downregulates gene expression of MyoD family inhibitor (MDFI) in U-937 macrophages
15207726 These results suggest that the physical and functional interaction between Zic and I-mfa proteins can play a role in the vertebrate development.
14530267 I-mfa functions as a molecular switch to suppress the store dependence of TRPC1

AA Sequence

MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIP      1 - 70
QGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQG     71 - 140
SKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECA    141 - 210
DCDLPCDLDCGILDACCESADCLEICMECCGLCFSS                                      211 - 246
//

Text Mined References (21)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21664411 2011 I-mfa domain proteins specifically interact with SERTA domain proteins and repress their transactivating functions.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19060904 2009 An empirical framework for binary interactome mapping.
17289077 2007 Developmental regulators containing the I-mfa domain interact with T cyclins and Tat and modulate transcription.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15207726 2004 Myogenic repressor I-mfa interferes with the function of Zic family proteins.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14530267 2003 Inhibitor of myogenic family, a novel suppressor of store-operated currents through an interaction with TRPC1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11238923 2001 Inhibition of Tcf3 binding by I-mfa domain proteins.
9799236 1998 Requirement of the mouse I-mfa gene for placental development and skeletal patterning.
9250874 1997 The gene encoding I-mf (Mdfi) maps to human chromosome 6p21 and mouse chromosome 17.
8797820 1996 I-mf, a novel myogenic repressor, interacts with members of the MyoD family.