Property Summary

NCBI Gene PubMed Count 99
PubMed Score 129.17
PubTator Score 134.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.109 2.2e-03
malignant mesothelioma 1.700 2.6e-07
psoriasis -2.300 4.6e-05
osteosarcoma -2.646 1.1e-06
group 3 medulloblastoma 2.100 9.7e-07
astrocytoma 1.100 2.4e-02
primitive neuroectodermal tumor 1.100 3.4e-04
gastric carcinoma 1.100 1.8e-02
ovarian cancer 1.400 4.7e-05
dermatomyositis 1.100 1.4e-03

Gene RIF (79)

PMID Text
26845027 MDC1 recruits TNKS1 and TNKS2 to DNA lesions.
26734725 The interaction of MDC1 with RNF8, but not with ATM requires WRAP53beta, suggesting that WRAP53beta facilitates the former interaction without altering phosphorylation of MDC1 by ATM.
26247734 MDC1 silencing enhances the radiosensitivity of human nasopharyngeal cancer CNE1 cells and results in xenograft tumor growth inhibition.
25976740 we generated two HEP-2 cell lines with a stable knockdown of MDC1 or 53BP1 with short hairpin RNA (shRNA), respectively, and investigated the effect of MDC1 and 53BP1 on cell radiosensitivity
25934801 The study suggest that MDC1 as an epigenetic modifier regulates androgen receptor transcriptional activity and MDC1 may function as a tumor suppressor of prostate cancer.
25627978 During replicative senescence and stress-induced premature senescence, MDC1 is downregulated by upregulating miR-22.
25592380 our findings suggest that MDC1 promotes ovarian cancer metastasis through the induction of EMT.
25514464 we have identified a novel antisense lncRNA MDC1-AS, which may participate in bladder cancer through up-regulation of its antisense tumor-suppressing gene MDC1
25198518 data suggested that the SNP rs4713354A>C of MDC1 may be a functional genetic biomarker for susceptibility to lung cancer in Chinese
24509855 ATM and MDC1 maintain genomic stability not only by controlling the DNA damage response, but also by regulating spindle assembly checkpoint activation, providing an important link between these two essential biological processes.
24349352 NFBD1/MDC1 is phosphorylated by PLK1 and controls G2/M transition through the regulation of a TOPOIIalpha-mediated decatenation checkpoint.
23891287 The TOPBP1 phosphate-binding pocket and positively charged residues in a variant loop in BRCT5 present an extended binding surface for the negatively charged MDC1 phosphopeptide.
23230272 PARP1 activation and BAL1-BBAP recruitment to DNA damage sites are independent of ATM and MDC1.
23038782 PALB2 localization depends on the presence of MDC1, RNF8, RAP80 and Abraxas upstream of BRCA1.
22962268 inhibition in the activity of the core mitotic regulator CDK1 enhances MDC1-gammaH2AX colocalization in mitosis.
22942284 A dual interaction between the DNA damage response protein MDC1 and the RAG1 subunit of the V(D)J recombinase.
22860035 proteins accumulate into foci with characteristic mean recruitment times tau(1). Mdc1 accumulates faster than 53BP1 after high LET irradiation
22677490 distinct dynamics of MDC1 and 53BP1 at different types of nuclear structures
22635276 It was shown that MDC1 is sumoylated after DNA damage, and sumoylation of MDC1 at Lys1840 is needed for MDC1 degradation and removal of MDC1 and 53BP1 from DNA damage sites. Sumoylated MDC1 was ubiquitinated by the SUMO-targeted E3 ubiquitin ligase RNF4.
22273583 As compared to the MDC1 forkhead-associated FHA) domain, the MU2 FHA domain dimerizes using a different and more stable interface and contains a degenerate phosphothreonine-binding pocket.
22234878 A major binding target of the Mdc1 FHA domain is a previously unidentified DNA damage and ATM-dependent phosphorylation site near the N-terminus of Mdc1 itself.
22211259 structural insight into MDC1-CHK2 interaction
21857162 MDC1 is required for the recruitment of RAP80 to DNA double-strand breaks.
21853275 expression of NFBD1 seems to be related to the oncogenic potential of cervical cancer, and suppression of its expression can inhibit cancer cell growth both in vitro and in vivo
21784059 this study reveals that human NIPBL is a novel protein recruited to DSB sites, and the recruitment is controlled by MDC1, RNF168 and HP1gamma.
21622030 This study provides the first evidence that interactions involving MDC1 can be regulated by ubiquitylation
21551225 most NFBD1 regulated genes are regulated in both the absence and presence of IR, thus pointing toward a novel function for NFBD1 outside of the DNA damage response
21482717 The specific TopBP1-MDC1 interaction was mediated by the fifth BRCT domain of TopBP1 and the Ser-Asp-Thr repeats of MDC1. TopBP1 accumulation at stalled replication forks was promoted by the H2AX/MDC1 signaling cascade.
21148072 Results implicate MDC1 in the cellular apoptotic response.
20813677 Silencing MDC1 can enhance the radiosensitivity of esophageal squamous cell carcinoma ECA109 cells in vitro.
20729195 The viral oncoprotein tax sequesters DNA damage response factors by tethering MDC1 to chromatin.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20529673 NFBD1 has a pivotal role in the regulation of proper mitotic entry.
20521098 Mediator of DNA damage checkpoint protein 1 (MDC1) has a role in nodal recurrence in early-stage breast cancer patients treated with breast-conserving surgery and radiation therapy
20364298 High NFBD1 is associated with esophageal cancer.
20159462 structure & peptide binding specificity of BRCT domains of MDC1 & BRCA1; crystal structures of BRCA1 & MDC1 bound to peptides show differences in the environment of conserved arginines that determine affinity for peptides with -COO(-) vs -CO-NH(2) termini
20081839 Data show that the ATM signalling mediator proteins MDC1, RNF8, RNF168 and 53BP1 are also required for heterochromatic DSB repair.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19826003 hMDC1 functionally regulates the normal metaphase-to-anaphase transition by modulating the Cdc20-dependent activation of the APC/C
19797077 Nucleotide excision repair-induced H2A ubiquitination is dependent on MDC1 and RNF8 and reveals a universal DNA damage response.
19690177 Observational study of gene-disease association. (HuGE Navigator)
19638463 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19001859 NFBD1, 53BP1 and BRCA1 have both unique and redundant functions in radiation-induced phosphorylation and localization events in the ATM-Chk2 pathway.
18986980 the interaction between 53BP1 and MDC1 plays a role in the regulation of mitosis
18757370 supports a novel mechanism for the disassembly of MDC1 foci via ubiquitin-proteasome dependent degradation, which appears to be a key step for the efficient assembly of BRCA1 foci
18678890 MDC1 regulates intra-S-phase checkpoint by targeting NBS1 to DNA double-strand breaks
18664457 Nbs1 has a function in ATR signalling in a manner distinct to any role at stalled replication forks. Replication-independent ATR signalling also requires the mediator proteins, 53BP1 and MDC1, providing direct evidence for their role in ATR signalling.
18635967 MDC1 and BRIT1 may function as tumor-suppressor genes, at least in part by orchestrating proper centrosome duplication and mitotic spindle assembly.
18583988 MDC1 is phosphorylated on a cluster of conserved repeat motifs by casein kinase 2 and this phosphorylation promotes direct, phosphorylation-dependent interactions with NBS1.
18582474 Structure-based single point mutations in Nbs1 were evaluated in vivo and revealed that BRCT2 is essential for an MDC1-dependent relocalization of Nbs1 to DNA damage sites.
18471438 NFBD1 directly interacts with MDM2 and increases its stability.
18411307 Ser-Asp-Thr repeats in the MDC1 N terminus recruit NBS1 and increase the local concentration of NBS1 at the sites of chromosomal breakage.
18173747 Sp1-mediated transcriptional regulation of NFBD1 plays an important role in the regulation of DNA damage response.
18001825 Phospho-dependent FHA domain-mediated binding of RNF8 to MDC1.
18001824 MDC1-mediated and RNF8-executed histone ubiquitylation protects genome integrity by licensing the DSB-flanking chromatin to concentrate repair factors near the DNA lesions.
17977515 We found six differentially expressed proteins; among them, the checkpoint mediator protein MDC1 whose expression was disrupted in FANCC-/- cells.
17925396 MCPH1 functions in an H2AX-dependent but MDC1-independent pathway in response to DNA damage
17884766 MDC1 and 53BP1 expressions were observed for the first time in human esophageal carcinoma cell lines TE-1,TE-13 and Eca109 cells, at both the mRNA and protein levels.
17827148 The results reveal a link between the cellular response to DNA damage and cell cycle regulation, suggesting that MDC1, known to have a role in checkpoint regulation, executes part of this role by binding the APC/C.
17546051 Contrary to carcinomas, almost no activation or loss of MDC1 or 53BP1 were found among testicular germ-cell tumours (TGCTs), a tumour type with unique biology and exceptionally low incidence of p53 mutations.
17535811 NFBD1 plays an important role in the decision of cell survival and death after DNA damage through the regulation of p53
17158742 MDC1 knockdown affected the formation of telomere dysfunction-induced foci.
16186822 MDC1 functions in Rad51-mediated homologous recombination by retaining Rad51 in chromatin.
16049003 structural analysis of the BRCT repeat domain of MDC1 and its specificity for the free COOH-terminal end of the gamma-H2AX histone tail
16009723 NFBD1Mdc1/NFBD1 as a key upstream determinant of 53BP1's interaction with DSBs.
15734998 Both 53BP1 and NFBD1 are required for recruitment of ATR to DNA damage sites, as well as for ATR-dependent phosphorylation in response to DNA damage.
15377652 MDC1 acts not only as a mediator of DNA damage checkpoint but also as a mediator of DNA damage repair
15279781 MDC1/NFBD1 appears to be a key regulator of the DNA damage response in mammalian cells [review]
15201865 MDC1 functions as an H2AFX-dependent interaction platform enabling a switch from transient, MDC1-independent interactions with the surrounding chromosomal environment.
14695167 In cells with wild-type Nbs1, suppression of 53BP1 expression had no effect on ATM activation but was associated with increased recruitment of NFBD1/MDC1 and Nbs1 to sites of DNA breaks.
14519663 NFBD1 has a role in DNA checkpoint signaling and recruits repair proteins to the sites of DNA damage.
12611903 MDC1 regulates BRCA1 function in DNA damage checkpoint control
12607005 role for MDC1 in mediating transduction of the DNA damage signal
12607004 MDC1 is recruited through its FHA domain to the activated CHK2 and has a critical role in CHK2-mediated DNA damage responses
12607003 MDC1-mediated focus formation by the MRE11 complex at sites of DNA damage is crucial for the efficient activation of the intra-S-phase checkpoint
12551934 NFBD1 is parallel to 53BP1 in regulating Chk2 and downstream of H2AX in the recruitment of repair and signaling proteins to sites of DNA damage in tumor cells
12499369 role in DNA damage signaling pathways
12475977 This nuclear protein with signature motifs of FHA and BRCT, and an internal 41-amino acid repeat sequence, is an early participant in DNA damage response.

AA Sequence

MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPS      1 - 70
ISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLPFV     71 - 140
SRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRMVKKSRTTSSSVIVPESDEEGHSPVLGGLGP    141 - 210
PFAFNLNSDTDVEEGQQPATEEASSAARRGATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGN    211 - 280
GVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKR    281 - 350
KIFHGVGTRGPGAPGLAHLQESQAGSDTDVEEGKAPQAVPLEKSQASMVINSDTDDEEEVSAALTLAHLK    351 - 420
ESQPAIWNRDAEEDMPQRVVLLQRSQTTTERDSDTDVEEEELPVENREAVLKDHTKIRALVRAHSEKDQP    421 - 490
PFGDSDDSVEADKSSPGIHLERSQASTTVDINTQVEKEVPPGSAIIHIKKHQVSVEGTNQTDVKAVGGPA    491 - 560
KLLVVSLEEAWPLHGDCETDAEEGTSLTASVVADVRKSQLPAEGDAGAEWAAAVLKQERAHEVGAQGGPP    561 - 630
VAQVEQDLPISRENLTDLVVDTDTLGESTQPQREGAQVPTGREREQHVGGTKDSEDNYGDSEDLDLQATQ    631 - 700
CFLENQGLEAVQSMEDEPTQAFMLTPPQELGPSHCSFQTTGTLDEPWEVLATQPFCLRESEDSETQPFDT    701 - 770
HLEAYGPCLSPPRAIPGDQHPESPVHTEPMGIQGRGRQTVDKVMGIPKETAERVGPERGPLERETEKLLP    771 - 840
ERQTDVTGEEELTKGKQDREQKQLLARDTQRQESDKNGESASPERDRESLKVEIETSEEIQEKQVQKQTL    841 - 910
PSKAFEREVERPVANRECDPAELEEKVPKVILERDTQRGEPEGGSQDQKGQASSPTPEPGVGAGDLPGPT    911 - 980
SAPVPSGSQSGGRGSPVSPRRHQKGLLNCKMPPAEKASRIRAAEKVSRGDQESPDACLPPTVPEAPAPPQ    981 - 1050
KPLNSQSQKHLAPPPLLSPLLPSIKPTVRKTRQDGSQEAPEAPLSSELEPFHPKPKIRTRKSSRMTPFPA   1051 - 1120
TSAAPEPHPSTSTAQPVTPKPTSQATRSRTNRSSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTRGR   1121 - 1190
KSRSSVKTPETVVPTALELQPSTSTDRPVTSEPTSQATRGRKNRSSVKTPEPVVPTAPELQPSTSTDQPV   1191 - 1260
TSEPTYQATRGRKNRSSVKTPEPVVPTAPELRPSTSTDRPVTPKPTSRTTRSRTNMSSVKTPETVVPTAP   1261 - 1330
ELQISTSTDQPVTPKPTSRTTRSRTNMSSVKNPESTVPIAPELPPSTSTEQPVTPEPTSRATRGRKNRSS   1331 - 1400
GKTPETLVPTAPKLEPSTSTDQPVTPEPTSQATRGRTNRSSVKTPETVVPTAPELQPSTSTDQPVTPEPT   1401 - 1470
SQATRGRTDRSSVKTPETVVPTAPELQASASTDQPVTSEPTSRTTRGRKNRSSVKTPETVVPAAPELQPS   1471 - 1540
TSTDQPVTPEPTSRATRGRTNRSSVKTPESIVPIAPELQPSTSRNQLVTPEPTSRATRCRTNRSSVKTPE   1541 - 1610
PVVPTAPEPHPTTSTDQPVTPKLTSRATRRKTNRSSVKTPKPVEPAASDLEPFTPTDQSVTPEAIAQGGQ   1611 - 1680
SKTLRSSTVRAMPVPTTPEFQSPVTTDQPISPEPITQPSCIKRQRAAGNPGSLAAPIDHKPCSAPLEPKS   1681 - 1750
QASRNQRWGAVRAAESLTAIPEPASPQLLETPIHASQIQKVEPAGRSRFTPELQPKASQSRKRSLATMDS   1751 - 1820
PPHQKQPQRGEVSQKTVIIKEEEEDTAEKPGKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQES   1821 - 1890
TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAG   1891 - 1960
FFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMP   1961 - 2030
RSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLEMSST              2031 - 2089
//

Text Mined References (119)

PMID Year Title
26845027 2016 Tankyrases Promote Homologous Recombination and Check Point Activation in Response to DSBs.
26734725 2015 The proximity ligation assay reveals that at DNA double-strand breaks WRAP53? associates with ?H2AX and controls interactions between RNF8 and MDC1.
26247734 2015 Silencing NFBD1/MDC1 enhances the radiosensitivity of human nasopharyngeal cancer CNE1 cells and results in tumor growth inhibition.
25976740 2015 Downregulation of MDC1 and 53BP1 by short hairpin RNA enhances radiosensitivity in laryngeal carcinoma cells.
25934801 2015 MDC1 functionally identified as an androgen receptor co-activator participates in suppression of prostate cancer.
25627978 2015 MicroRNA-22 Suppresses DNA Repair and Promotes Genomic Instability through Targeting of MDC1.
25592380 2015 MDC1 promotes ovarian cancer metastasis by inducing epithelial-mesenchymal transition.
25514464 2015 A novel antisense long noncoding RNA regulates the expression of MDC1 in bladder cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25198518 2014 A Newfound association between MDC1 functional polymorphism and lung cancer risk in Chinese.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24550317 2014 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
24509855 2014 Interplay between the DNA damage proteins MDC1 and ATM in the regulation of the spindle assembly checkpoint.
24349352 2013 NFBD1/MDC1 is phosphorylated by PLK1 and controls G2/M transition through the regulation of a TOPOII?-mediated decatenation checkpoint.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24217620 2013 The histone demethylase LSD1/KDM1A promotes the DNA damage response.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23891287 2013 Structural insights into recognition of MDC1 by TopBP1 in DNA replication checkpoint control.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23230272 2013 BAL1 and its partner E3 ligase, BBAP, link Poly(ADP-ribose) activation, ubiquitylation, and double-strand DNA repair independent of ATM, MDC1, and RNF8.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23038782 2012 MDC1 and RNF8 function in a pathway that directs BRCA1-dependent localization of PALB2 required for homologous recombination.
22962268 2012 CDK1 regulates mediator of DNA damage checkpoint 1 during mitotic DNA damage.
22942284 2012 A dual interaction between the DNA damage response protein MDC1 and the RAG1 subunit of the V(D)J recombinase.
22860035 2012 Recruitment kinetics of DNA repair proteins Mdc1 and Rad52 but not 53BP1 depend on damage complexity.
22677490 2012 The in vivo dynamic interplay of MDC1 and 53BP1 at DNA damage-induced nuclear foci.
22635276 2012 Sumoylation of MDC1 is important for proper DNA damage response.
22273583 2012 Dimerization, but not phosphothreonine binding, is conserved between the forkhead-associated domains of Drosophila MU2 and human MDC1.
22234878 2012 The molecular basis of ATM-dependent dimerization of the Mdc1 DNA damage checkpoint mediator.
22234877 2012 Structural mechanism of the phosphorylation-dependent dimerization of the MDC1 forkhead-associated domain.
22211259 2012 Structural delineation of MDC1-FHA domain binding with CHK2-pThr68.
22139841 2012 Molecular basis for the association of microcephalin (MCPH1) protein with the cell division cycle protein 27 (Cdc27) subunit of the anaphase-promoting complex.
21857162 2011 Recruitment of proteins to DNA double-strand breaks: MDC1 directly recruits RAP80.
21853275 2012 NFBD1/MDC1 is a protein of oncogenic potential in human cervical cancer.
21784059 2011 Recruitment of the cohesin loading factor NIPBL to DNA double-strand breaks depends on MDC1, RNF168 and HP1? in human cells.
21622030 2011 MDC1 is ubiquitylated on its tandem BRCT domain and directly binds RAP80 in a UBC13-dependent manner.
21551225 2011 NFBD1/MDC1 regulates Cav1 and Cav2 independently of DNA damage and p53.
21482717 2011 MDC1 collaborates with TopBP1 in DNA replication checkpoint control.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21148072 2011 MDC1 cleavage by caspase-3: a novel mechanism for inactivating the DNA damage response during apoptosis.
20813677 2010 [Short hairpin RNA-mediated MDC1 gene silencing enhances the radiosensitivity of esophageal squamous cell carcinoma cell line ECA109].
20729195 2010 The viral oncoprotein tax sequesters DNA damage response factors by tethering MDC1 to chromatin.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20529673 2010 NFBD1/MDC1 participates in the regulation of G2/M transition in mammalian cells.
20521098 2011 Mediator of DNA damage checkpoint protein 1 (MDC1) expression as a prognostic marker for nodal recurrence in early-stage breast cancer patients treated with breast-conserving surgery and radiation therapy.
20364298 2010 Growth inhibition, morphology change, and cell cycle alterations in NFBD1-depleted human esophageal cancer cells.
20224574 2010 A divalent FHA/BRCT-binding mechanism couples the MRE11-RAD50-NBS1 complex to damaged chromatin.
20159462 2010 Comparison of the structures and peptide binding specificities of the BRCT domains of MDC1 and BRCA1.
20081839 2010 53BP1-dependent robust localized KAP-1 phosphorylation is essential for heterochromatic DNA double-strand break repair.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20008512 2010 CK2 phosphorylation-dependent interaction between aprataxin and MDC1 in the DNA damage response.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19826003 2009 Mediator of DNA damage checkpoint 1 (MDC1) regulates mitotic progression.
19804756 2009 A supramodular FHA/BRCT-repeat architecture mediates Nbs1 adaptor function in response to DNA damage.
19797077 2009 Nucleotide excision repair-induced H2A ubiquitination is dependent on MDC1 and RNF8 and reveals a universal DNA damage response.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19638463 2009 Sequence variant discovery in DNA repair genes from radiosensitive and radiotolerant prostate brachytherapy patients.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19001859 2008 NFBD1/MDC1, 53BP1 and BRCA1 have both redundant and unique roles in the ATM pathway.
18986980 2009 The direct interaction between 53BP1 and MDC1 is required for the recruitment of 53BP1 to sites of damage.
18757370 2008 Disassembly of MDC1 foci is controlled by ubiquitin-proteasome-dependent degradation.
18678890 2008 MDC1 regulates intra-S-phase checkpoint by targeting NBS1 to DNA double-strand breaks.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18664457 2008 Replication independent ATR signalling leads to G2/M arrest requiring Nbs1, 53BP1 and MDC1.
18635967 2008 Differential regulation of centrosome integrity by DNA damage response proteins.
18583988 2008 Phospho-dependent interactions between NBS1 and MDC1 mediate chromatin retention of the MRN complex at sites of DNA damage.
18582474 2008 Structure of a second BRCT domain identified in the nijmegen breakage syndrome protein Nbs1 and its function in an MDC1-dependent localization of Nbs1 to DNA damage sites.
18471438 2008 NFBD1/MDC1 stabilizes oncogenic MDM2 to contribute to cell fate determination in response to DNA damage.
18411307 2008 Phosphorylation of SDT repeats in the MDC1 N terminus triggers retention of NBS1 at the DNA damage-modified chromatin.
18283122 2008 Cep164 is a mediator protein required for the maintenance of genomic stability through modulation of MDC1, RPA, and CHK1.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18173747 2008 Sp1-mediated transcriptional regulation of NFBD1/MDC1 plays a critical role in DNA damage response pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006705 2007 Orchestration of the DNA-damage response by the RNF8 ubiquitin ligase.
18001825 2007 RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
18001824 2007 RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.
17977515 2007 Changes in protein expression due to deleterious mutations in the FA/BRCA pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17925396 2007 MCPH1 functions in an H2AX-dependent but MDC1-independent pathway in response to DNA damage.
17884766 2007 [Expression of DNA damage checkpoint mediator 1 and p53-binding protein 1 in human esophageal cancer cell lines TE-1, TE-13, and Eca109].
17827148 2007 The DNA damage response mediator MDC1 directly interacts with the anaphase-promoting complex/cyclosome.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17546051 2007 DNA damage response mediators MDC1 and 53BP1: constitutive activation and aberrant loss in breast and lung cancer, but not in testicular germ cell tumours.
17535811 2007 NFBD1/MDC1 associates with p53 and regulates its function at the crossroad between cell survival and death in response to DNA damage.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17158742 2006 MDC1 accelerates nonhomologous end-joining of dysfunctional telomeres.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16427010 2006 H2AX prevents DNA breaks from progressing to chromosome breaks and translocations.
16377563 2005 MDC1 directly binds phosphorylated histone H2AX to regulate cellular responses to DNA double-strand breaks.
16186822 2005 MDC1 interacts with Rad51 and facilitates homologous recombination.
16051665 2005 Proteomic analysis of steady-state nuclear hormone receptor coactivator complexes.
16049003 2005 Structure of the BRCT repeat domain of MDC1 and its specificity for the free COOH-terminal end of the gamma-H2AX histone tail.
16009723 2005 Dynamic assembly and sustained retention of 53BP1 at the sites of DNA damage are controlled by Mdc1/NFBD1.
15734998 2005 NFBD1/Mdc1 mediates ATR-dependent DNA damage response.
15604234 2004 NIMA-related protein kinase 1 is involved early in the ionizing radiation-induced DNA damage response.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15377652 2004 MDC1 regulates DNA-PK autophosphorylation in response to DNA damage.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15279781 MDC1/NFBD1: a key regulator of the DNA damage response in higher eukaryotes.
15201865 2004 Mdc1 couples DNA double-strand break recognition by Nbs1 with its H2AX-dependent chromatin retention.
14695167 2003 53BP1 and NFBD1/MDC1-Nbs1 function in parallel interacting pathways activating ataxia-telangiectasia mutated (ATM) in response to DNA damage.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14519663 2003 NFBD1/MDC1 regulates ionizing radiation-induced focus formation by DNA checkpoint signaling and repair factors.
12611903 2003 Mediator of DNA damage checkpoint protein 1 regulates BRCA1 localization and phosphorylation in DNA damage checkpoint control.
12607005 2003 MDC1 is a mediator of the mammalian DNA damage checkpoint.
12607004 2003 MDC1 is coupled to activated CHK2 in mammalian DNA damage response pathways.
12607003 2003 MDC1 is required for the intra-S-phase DNA damage checkpoint.
12556884 2003 DNA damage activates ATM through intermolecular autophosphorylation and dimer dissociation.
12551934 2003 NFBD1, like 53BP1, is an early and redundant transducer mediating Chk2 phosphorylation in response to DNA damage.
12499369 2003 NFBD1/KIAA0170 is a chromatin-associated protein involved in DNA damage signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475977 2003 NFBD1, a novel nuclear protein with signature motifs of FHA and BRCT, and an internal 41-amino acid repeat sequence, is an early participant in DNA damage response.
10975465 2000 NFBD1/KIAA0170 is a novel nuclear transcriptional transactivator with BRCT domain.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.