Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.05
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-04
Breast cancer 1.300 4.5e-17
diabetes mellitus 1.800 1.7e-03
group 4 medulloblastoma -1.200 1.4e-05
lung adenocarcinoma 1.500 3.9e-12
osteosarcoma 1.703 1.0e-03
ovarian cancer 1.300 4.0e-05
pancreatic ductal adenocarcinoma liver m... -1.169 2.3e-03
ulcerative colitis -1.400 9.5e-07

Synonym

Accession Q9BUT9 Q969E9 Q96KV8
Symbols FAM195A
C16orf14
c349E10.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSPGPRLVFNR      1 - 70
VNGRRAPSTSPSFEGTQETYTVAHEENVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFV     71 - 140
PIDLDEWWAQQFLARITSCS                                                      141 - 160
//

Text Mined References (14)

PMID Year Title