Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.36
PubTator Score 0.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKV      1 - 70
PNPSLKTFKPIDLSDLKRRSTQDAKKS                                                71 - 97
//

Text Mined References (11)

PMID Year Title