Property Summary

Ligand Count 5
NCBI Gene PubMed Count 21
PubMed Score 16.53
PubTator Score 19.81

Knowledge Summary

Patent (8,871)

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.930 2.1e-02
Atopic dermatitis -1.100 1.0e-03
cutaneous lupus erythematosus -1.600 2.8e-03
cystic fibrosis 1.578 2.0e-04
ductal carcinoma in situ -1.200 1.8e-02
interstitial cystitis -1.500 7.8e-03
intraductal papillary-mucinous adenoma (... -2.500 9.2e-06
intraductal papillary-mucinous carcinoma... -1.800 2.3e-02
invasive ductal carcinoma -1.500 1.8e-02
lung adenocarcinoma -1.300 1.3e-09
lung cancer 3.100 2.4e-05
medulloblastoma, large-cell 1.100 7.1e-05
non-small cell lung cancer -1.131 8.3e-08
osteosarcoma 2.823 4.6e-03
ovarian cancer -1.200 7.3e-17
pancreatic cancer -1.100 3.3e-04
pituitary cancer -1.300 1.9e-02
posterior fossa group B ependymoma 1.200 2.8e-04
psoriasis -1.100 1.2e-05
sonic hedgehog group medulloblastoma 1.300 1.1e-02

 GO Function (1)

 GWAS Trait (1)

Gene RIF (13)

AA Sequence

MADPEVVVSSCSSHEEENRCNFNQQTSPSEELLLEDQMRRKLKFFFMNPCEKFWARGRKPWKLAIQILKI      1 - 70
AMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVS     71 - 140
VGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDF    141 - 210
HRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQK    211 - 280
NTHYMMIFDAFVILTCLVSLILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDI    281 - 350
LTIIGSILKMEIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAA    351 - 420
MIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSRIYLYSFISLFI    421 - 490
YMILSLFIALITDTYETIKQYQQDGFPETELRTFISECKDLPNSGKYRLEDDPPVSLFCCCKK           491 - 553
//

Text Mined References (23)

PMID Year Title