Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.80
PubTator Score 9.98

Knowledge Summary

Patent (809)

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.146 2.0e-02
adrenocortical carcinoma -1.544 3.3e-03
chronic lymphosyte leukemia 1.900 1.2e-09
interstitial cystitis 2.000 9.8e-03
invasive ductal carcinoma 1.646 2.0e-03
lung carcinoma -1.800 1.3e-16
medulloblastoma, large-cell 1.200 1.1e-03
osteosarcoma 1.133 1.8e-02
ovarian cancer -2.100 7.2e-08
primary Sjogren syndrome 2.100 2.2e-04
tuberculosis -1.100 6.4e-06
ulcerative colitis -1.700 1.0e-04

 GO Function (1)

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKFYFMSPCEKYRARRQIPWKLGLQI      1 - 70
LKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDEDDYSCSVYTQEDAYESIFFAINQYHQ     71 - 140
LKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSF    141 - 210
FRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIF    211 - 280
GSTQKNAQYVLVFDAFVIVICLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFINGWYVLV    281 - 350
IISDLMTIIGSILKMEIKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRF    351 - 420
CACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVWLFSRLYLYSF    421 - 490
ISLFIYMILSLFIALITDSYDTIKKFQQNGFPETDLQEFLKECSSKEEYQKESSAFLSCICCRRRKRSDD    491 - 560
HLIPIS                                                                    561 - 566
//

Text Mined References (17)

PMID Year Title