Property Summary

Ligand Count 2
NCBI Gene PubMed Count 72
PubMed Score 272.22
PubTator Score 184.64

Knowledge Summary

Patent (48,723)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Mucolipidoses 1 0.0 0.0
Disease Target Count Z-score Confidence
Gangliosidosis 20 7.425 3.7
Disease Target Count Z-score Confidence
Glycoproteinosis 12 0.0 4.0
Disease Target Count Z-score Confidence
Yunis-Varon syndrome 6 3.992 2.0
Disease Target Count
Mucolipidosis Type IV 2

Expression

 OMIM Phenotype (1)

Gene RIF (52)

AA Sequence

MTAPAGPRGSETERLLTPNPGYGTQAGPSPAPPTPPEEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQV      1 - 70
VKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALP     71 - 140
DVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLT    141 - 210
LLESSSSYKNLTLKFHKLVNVTIHFRLKTINLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAH    211 - 280
IQECKHPSVFQHGDNSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVGFMWRQRGRVISLWERLEF    281 - 350
VNGWYILLVTSDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRV    351 - 420
ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGRSSLV    421 - 490
WLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSA    491 - 560
CSLLCCCGRDPSEEHSLLVN                                                      561 - 580
//

Text Mined References (77)

PMID Year Title