Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.49
PubTator Score 9.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.100 6.6e-06
osteosarcoma 1.154 3.7e-04
medulloblastoma, large-cell 1.100 8.3e-05
primitive neuroectodermal tumor 1.200 1.1e-02
acute quadriplegic myopathy 1.016 1.6e-05
primary pancreatic ductal adenocarcinoma 1.174 2.9e-02
group 3 medulloblastoma 1.400 1.3e-03
non primary Sjogren syndrome sicca 1.200 2.7e-02
ovarian cancer 2.200 4.9e-05

 GO Function (1)

Gene RIF (8)

PMID Text
25246271 the MCMBP protein accumulates to high levels in cancer cells, whereas in normal proliferating tissue its abundance is low, indicating that MCMBP could be exploited as a novel diagnostic marker for this type of carcinoma.
24190967 Data indicate that MCM-BP binds USP7 on chromatin and can mediate an interaction between the USP7 and MCM proteins.
22540012 MCM-BP can decrease phosphorylation by DDK but is not a substrate.
22250201 results suggest that MCM-BP makes multiple contributions to human cells that are not limited to unloading of the MCM complex
21196493 MCM-BP silencing in human cells also delays MCM dissociation in late S phase
20090939 Knockdown of the human ETG1 results in defective chromatid cohesion.
17296731 MCM-BP is conserved in multicellular eukaryotes and shares limited homology with MCM proteins. MCM-BP formed a complex with MCM3 to MCM7, which excluded MCM2.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPCGEDWLSHPLGIVQGFFAQNGVNPDWEKKVIEYFKEKLKENNAPKWVPSLNEVPLHYLKPNSFVKFRC      1 - 70
MIQDMFDPEFYMGVYETVNQNTKAHVLHFGKYRDVAECGPQQELDLNSPRNTTLERQTFYCVPVPGESTW     71 - 140
VKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEA    141 - 210
STGQQLNSLNLSSPFDLNFPLPGEKGPACLVKVYEDWDCFKVNDILELYGILSVDPVLSILNNDERDASA    211 - 280
LLDPMECTDTAEEQRVHSPPASLVPRIHVILAQKLQHINPLLPACLNKEESKTCKFVSSFMSELSPVRAE    281 - 350
LLGFLTHALLGDSLAAEYLILHLISTVYTRRDVLPLGKFTVNLSGCPRNSTFTEHLYRIIQHLVPASFRL    351 - 420
QMTIENMNHLKFIPHKDYTANRLVSGLLQLPSNTSLVIDETLLEQGQLDTPGVHNVTALSNLITWQKVDY    421 - 490
DFSYHQMEFPCNINVFITSEGRSLLPADCQIHLQPQLIPPNMEEYMNSLLSAVLPSVLNKFRIYLTLLRF    491 - 560
LEYSISDEITKAVEDDFVEMRKNDPQSITADDLHQLLVVARCLSLSAGQTTLSRERWLRAKQLESLRRTR    561 - 630
LQQQKCVNGNEL                                                              631 - 642
//

Text Mined References (30)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
25246271 2014 Deregulation of the replisome factor MCMBP prompts oncogenesis in colorectal carcinomas through chromosomal instability.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24190967 2014 A role for USP7 in DNA replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22250201 2012 The MCM-associated protein MCM-BP is important for human nuclear morphology.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21196493 2011 MCM-BP regulates unloading of the MCM2-7 helicase in late S phase.
20679368 2010 Identification of proteins that may directly interact with human RPA.
20090939 2010 The MCM-binding protein ETG1 aids sister chromatid cohesion required for postreplicative homologous recombination repair.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17296731 2007 Identification and characterization of a novel component of the human minichromosome maintenance complex.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.