Property Summary

NCBI Gene PubMed Count 37
PubMed Score 25.20
PubTator Score 13.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -1.675 1.2e-05
glioblastoma 1.600 2.5e-06
group 3 medulloblastoma 2.100 2.8e-04
cystic fibrosis -1.129 8.7e-05
atypical teratoid / rhabdoid tumor 1.400 1.4e-06
medulloblastoma, large-cell 1.900 2.1e-03
primitive neuroectodermal tumor 1.600 8.0e-04
adrenocortical carcinoma 1.417 1.7e-04
non-small cell lung cancer 1.638 1.3e-19
pediatric high grade glioma 1.700 3.6e-05
lung adenocarcinoma 1.400 5.3e-10
nasopharyngeal carcinoma 1.800 4.8e-05
Breast cancer 1.100 1.9e-08
invasive ductal carcinoma 1.100 6.7e-04
ovarian cancer -1.100 9.9e-05

Protein-protein Interaction (2)

Gene RIF (14)

PMID Text
26823731 Suggest role for MCM8 in the pathogenesis of chronic myelogenous leukemia.
25873734 MCM8, a component of the pre-replication complex, is crucial for gonadal development and maintenance in humans-both males and females. These
25437880 An autosomal recessive ovarian failure disorder caused by an MCM8 mutation that manifests with endocrine dysfunction and genomic instability.
23401855 Chromatin immunoprecipitation analysis using human DR-GFP cells demonstrated that MCM8 and MCM9 proteins are rapidly recruited to DNA damage sites and promote RAD51 recruitment.
22696150 Single Nucleotide Polymorphism in MCM8 is associated with ovarian follicle number and menopause.
22131368 Single nucleotide polymorphism in MCM8 is associated with menopause and the length of reproductive lifespan.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19448621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19448619 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18072282 We find that MCM8, like MCM7, colocalizes on a specific DNA segment of the c-MYC replication initiation zone (c-MYC replicator) of DNA replications together with Cdc6 and cdk2, but differs with MCM7 in spatial relation to RPA70 during S phase.
15684404 MCM8 is a crucial component of the pre-RC and that the interaction between hMCM8 and hcdc6 is required for pre-RC assembly.
12771218 The MCM8 gene is located contrapodal to GCD10 at chromosome band 20p12.3-13.

AA Sequence

MNGEYRGRGFGRGRFQSWKRGRGGGNFSGKWREREHRPDLSKTTGKRTSEQTPQFLLSTKTPQSMQSTLD      1 - 70
RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPD     71 - 140
IATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNV    141 - 210
RANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSS    211 - 280
PLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDK    281 - 350
CMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELV    351 - 420
KAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTTSGLTVT    421 - 490
LSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSISLAKAGVVCSLPARTSIIAAA    491 - 560
NPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEHHDHLLSEHVIAIRAGKQRTISSATVARMNS    561 - 630
QDSNTSVLEVVSEKPLSERLKVVPGETIDPIPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQS    631 - 700
QRLNSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGM    701 - 770
SNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM    771 - 840
//

Text Mined References (39)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26823731 2015 Expression of minichromosome maintenance 8 in chronic myelogenous leukemia.
25873734 2015 Minichromosome maintenance complex component 8 (MCM8) gene mutations result in primary gonadal failure.
25437880 2015 Exome sequencing reveals MCM8 mutation underlies ovarian failure and chromosomal instability.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23401855 2013 The MCM8-MCM9 complex promotes RAD51 recruitment at DNA damage sites to facilitate homologous recombination.
23307926 2013 A genome-wide association study of early menopause and the combined impact of identified variants.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22771115 2012 Mcm8 and Mcm9 form a complex that functions in homologous recombination repair induced by DNA interstrand crosslinks.
22696150 2012 Genetic markers of ovarian follicle number and menopause in women of multiple ethnicities.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
22131368 2012 Replication of loci influencing ages at menarche and menopause in Hispanic women: the Women's Health Initiative SHARe Study.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20205591 2010 Host determinants of HIV-1 control in African Americans.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19448621 2009 Genome-wide association studies identify loci associated with age at menarche and age at natural menopause.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
18072282 2008 Colocalization of MCM8 and MCM7 with proteins involved in distinct aspects of DNA replication.
16325355 2006 Comparative genomics on MCM8 orthologous genes reveals the transcriptional regulation by transcription factor E2F.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15684404 2005 Involvement of human MCM8 in prereplication complex assembly by recruiting hcdc6 to chromatin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12771218 2003 A new member of the MCM protein family encoded by the human MCM8 gene, located contrapodal to GCD10 at chromosome band 20p12.3-13.
12527764 2003 Identification and functional characterization of a new member of the human Mcm protein family: hMcm8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045100 2002 DNA replication in eukaryotic cells.
11931757 2002 Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11125146 2000 Inhibition of eukaryotic DNA replication by geminin binding to Cdt1.
11095689 2000 The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.
10436018 1999 The Cdc6 nucleotide-binding site regulates its activity in DNA replication in human cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.