Property Summary

NCBI Gene PubMed Count 124
PubMed Score 364.07
PubTator Score 127.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.900 1.1e-06
oligodendroglioma 1.600 9.1e-14
astrocytoma 1.500 1.6e-17
glioblastoma 2.400 1.3e-05
posterior fossa group A ependymoma 1.200 2.9e-04
group 3 medulloblastoma 3.400 7.6e-07
atypical teratoid / rhabdoid tumor 2.200 9.9e-06
medulloblastoma, large-cell 3.100 1.7e-05
primitive neuroectodermal tumor 2.600 9.9e-06
adrenocortical carcinoma 1.246 1.4e-02
non-small cell lung cancer 1.819 4.0e-21
lung cancer 1.200 3.5e-04
pediatric high grade glioma 2.200 2.3e-07
nasopharyngeal carcinoma 1.100 9.1e-04
lung adenocarcinoma 1.164 2.6e-04
Endometriosis 1.173 4.5e-02
ovarian cancer 1.200 2.0e-03

Gene RIF (59)

PMID Text
26504025 High MCM-7 expression correlated with Cutaneous T-cell Lymphomas.
26188516 KCTD5 is not involved in polyubiquitylation of MCM7 replication factor.Formation of trimeric complexes of KCTD5/cullin3 with MCM7, ZNF711 and FAM193B.
25661590 Purified MCM4/6/7 complex containing the G364R MCM4 exhibited similar levels of single-stranded DNA binding and ATPase activities to the complex containing wild-type MCM4
25425645 MCM7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor
25075101 expression of MCM7 is an independent risk factor for recurrence-free survival in patients with Dukes C colorectal cancer
25046975 Results show that in Glioma patients, MCM 2, MCM3 and MCM7 mRNA are up-regulated and correlated with poor outcome.
24805087 MCM7 and G9a may serve as effective prognostic factors and could also be used as biomarkers for predicting various clinical outcomes of oesophageal squamous cell carcinoma
24647462 MCM7 expression may be a useful prognosis indicator in patients with diffuse-type gastric adenocarcinoma and its knockdown by RNA interference quenches its oncogenic property in gastric cancer
24496236 We observed that lower levels of MCM7 correlate with reduced cell proliferation, lower autophagic capacity, and higher intracellular protein abundance phenotypes of aged and systemic sclerosis cells.
24416400 The A to G base change in SNP rs999885 of MCM7 may provide a protective effect on the prognosis of intermediate or advanced hepatocellular carcinoma in the Chinese.
24324072 present study aimed to investigate the relationship between expression of minichromosome maintenance proteins (MCM-3, MCM-7), metallothioneins (MT-I/II, MT-III), and Ki-67 in 103 ovarian cancer cases, mostly of the serous histological type
24190967 Data indicate that MCM-BP binds USP7 on chromatin and can mediate an interaction between the USP7 and MCM proteins.
24166506 Knockdown of MCM7 expression reduces glioblastoma multiforme cell proliferation and inhibits xenograft tumor growth in mice.
23860238 MCM 7, geminin and topo IIalpha can be reliable tools for the differential diagnosis of reactive mesothelial cells and malignant mesothelioma cells.
23803736 ORC/Cdc6/MCM2-7 complex is a new regulatory mechanism for the helicase.
23764002 EGFR enhances MCM7 phosphorylation and DNA replication through Lyn phosphorylation in human cancer cells.
23720738 MCM7 is a substrate of cyclin E/Cdk2 and can be phosphorylated on Ser-121.
23318911 Protein levels of MCM7 and p63 were associated significantly with high-grade cervical lesion, and aberrant p63 protein level may distinguish different histopathologic types of cervical carcinoma.
23313748 MCM7 interacts with the receptor for activated protein kinase C 1 (RACK1), a protein kinase C (PKC) adaptor, in vivo and in vitro.
23201130 the expression of cyclin D1, MCM7, TRIM29, and UBE2C was found to be significantly associated with progression to muscle-invasive bladder cancer.
23166591 Expression of HIV-1 Tat upregulates the abundance of minichromosome maintenance complex component 7 (MCM7) in the nucleoli of Jurkat T-cells
23125841 Expression of HIV-1 Tat upregulates the abundance of minichromosome maintenance complex component 7 (MCM7) in the nucleoli of Jurkat T-cells
22918583 Mcm2-7 loads onto origins during initiation as a double hexamer, yet does not act as a double-stranded DNA pump during elongation.
22784096 MCM7 expression may be a useful predictor of prognosis in patients with hepatocellular carcinoma after resection.
22456526 MCM7 and Ki67 in tumor tissues may be potential markers of a poor prognosis for non-small cell lung cancer patients
22190034 Expression of HIV-1 Tat upregulates the abundance of minichromosome maintenance complex component 7 (MCM7) in the nucleoli of Jurkat T-cells
21965782 Lymph node sections from 138 HL patients were immunohistochemically stained for cyclin D3 (CCND3), MCM2 and MCM7 aiming to investigate clinical outcome.
21619671 elevated expression of MCM7 to be associated with poor prognosis for patients with non-small cell lung cancer
21478101 low level of MCM7 of proteins expression which may explain commonly known low mitotic activity of desmoid tumour cells
21078875 Results demonstrate that interaction with Mcm7 is essential for the function of cyclin A in promoting S-phase entry.
21076460 MCM7 expression was significantly higher in high-grade serous carcinomas than in serous borderline tumors or other histological subtypes of ovarian cancer.
20661220 deregulation of MCM2, MCM3 and MCM7 expression might be involved in medulloblastoma tumorigenesis
20508983 Observational study of gene-disease association. (HuGE Navigator)
20388916 uncovered a proto-oncogenic miRNA-dependent network for PTEN regulation and defined the MCM7 locus as a critical factor in initiating prostate tumorigenesis
20236609 Transcriptional activation of Mcm7 is mediated by HAT recruitment to the promoter region upon C. sinensis excretory-secretory products treatment.
20048674 distribution pattern is similar to Ki-67;can be used as proliferation marker in experimental neoplasms
19834905 MCM7 , critical for cell proliferation and maintenance of genome stability, are markedly down-regulated, Data hypothesized that their DNA-related functions could be partially limited in TRAIL-resistant HL-60 cells.
19805216 interactions between Cdc45, Mcm2-7, and the GINS complex (collectively called the CMG complex), which seem to play a key role in the formation and progression of replication forks
19696745 Replisome factors MCM10, MCM2and MCM7 helicase, are the primary interaction partner proteins of human RECQ4.
19454010 Expression of HIV-1 Tat upregulates the abundance of minichromosome maintenance complex component 7 (MCM7) in the nucleoli of Jurkat T-cells
19401682 Observational study of gene-disease association. (HuGE Navigator)
19318354 the MCM2-7 proteins are co-localized with RNA Pol II on chromatins of constitutively transcribing genes, and MCM5 is required for transcription elongation of RNA Pol II.
19189662 RT-PCR and immunohistochemistry indicated positive expressions of Mcm7 mRNA and protein in normal oral mucosa, precancerous lesions and oral squamous cell carcinoma.
19144445 MCM7 is an independent prognostic marker in lung adenocarcinomas
18636144 MCM7 expression is an independent prognostic factor for human colorectal cancer
18072282 We find that MCM8, like MCM7, colocalizes on a specific DNA segment of the c-MYC replication initiation zone (c-MYC replicator) of DNA replications together with Cdc6 and cdk2, but differs with MCM7 in spatial relation to RPA70 during S phase.
17557111 MCM7 is part of the GINS complex.
17310990 INT6 stabilizes chromatin-bound MCM7 and alteration of this effect is associated with replication deficiency.
17094475 Increase of the MCM7 is associated with tumor aggressiveness in astrocytoma
16703398 MCM7, the c-myc-regulated gene is involved in genotype-C-HBV-related HCC, suggesting that c-myc is related to the hepatocarcinogenic activity of genotype-C HBV.
16289477 p27Kip1 binds the conserved minichromosome maintenance domain of MCM7 proteins in a growth factor-dependent manner, such that the carboxyl terminal domain of p27Kip1 inhibits DNA replication independent of its function as a cyclin-dependent kinase
16247466 MCM7 amplification is responsible for markedly increased DNA synthesis, cell proliferation and an increased cell invasion in prostate cancer.
15720416 MCM7 was found to be a more reliable and useful marker than Ki67 in assessing tumour proliferation and in the prognosis of patients.
15654075 interaction between endogenous Plk1 and Mcm7 was detected in a soluble chromatin fraction. These findings suggest a new function for Plk1 in coordination of DNA replication and mitotic events.
15538388 hMCM7 plays a direct role in the transmission of DNA damage signals from active replication forks to the S-phase checkpoint machinery in human cells.
15210935 ATM/ATR-dependent (ataxia-telangiectasia-mutated/ATM- and Rad3-related) checkpoint pathways are directly linked to three members of the MCM complex(MCM2,MCM3,MCM7).
14678972 MCM7 may be a highly informative biomarker for cervical cancer.
14550576 Overexpressed MCM7 protein supports efficient DNA replication of Epstein-Barr virus oriP and rapid formation of tumors in nude mice without altering the activity of cellular DNA replication.
11861392 Minichromosome maintenance protein MCM7 is a direct target of the MYCN transcription factor in neuroblastoma.

AA Sequence

MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENA      1 - 70
RRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG     71 - 140
PSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQE    141 - 210
CQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPI    211 - 280
LRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV    281 - 350
KKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR    351 - 420
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANP    421 - 490
AYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMR    491 - 560
RYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDV    561 - 630
NEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE    631 - 700
YEELNVWQVNASRTRITFV                                                       701 - 719
//

Text Mined References (135)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26504025 2015 Expression of MCM-3 and MCM-7 in Primary Cutaneous T-cell Lymphomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26188516 2015 Interactions of cullin3/KCTD5 complexes with both cytoplasmic and nuclear proteins: Evidence for a role in protein stabilization.
25661590 2015 G364R mutation of MCM4 detected in human skin cancer cells affects DNA helicase activity of MCM4/6/7 complex.
25425645 2015 The DNA replication licensing factor miniature chromosome maintenance 7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25075101 2014 Minichromosome maintenance protein 7 is a risk factor for recurrence in patients with Dukes C colorectal cancer.
25046975 2014 Minichromosome Maintenance (MCM) Family as potential diagnostic and prognostic tumor markers for human gliomas.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24805087 2015 Overexpression of G9a and MCM7 in oesophageal squamous cell carcinoma is associated with poor prognosis.
24647462 2014 MCM7 serves as a prognostic marker in diffuse-type gastric adenocarcinoma and siRNA-mediated knockdown suppresses its oncogenic function.
24496236 2014 Altered MCM protein levels and autophagic flux in aged and systemic sclerosis dermal fibroblasts.
24416400 2014 A genetic variant in the promoter region of miR-106b-25 cluster predict clinical outcome of HBV-related hepatocellular carcinoma in Chinese.
24324072 2013 Comparison of minichromosome maintenance proteins (MCM-3, MCM-7) and metallothioneins (MT-I/II, MT-III) expression in relation to clinicopathological data in ovarian cancer.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24190967 2014 A role for USP7 in DNA replication.
24166506 2014 Depletion of minichromosome maintenance protein 7 inhibits glioblastoma multiforme tumor growth in vivo.
23860238 2013 Differential diagnosis of reactive mesothelial cells and malignant mesothelioma cells using the cell proliferation markers minichromosome maintenance protein 7, geminin, topoisomerase II alpha and Ki-67.
23803736 2013 The ORC/Cdc6/MCM2–7 complex, a new power player for regulated helicase loading.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23720738 2013 Phosphorylation of minichromosome maintenance protein 7 (MCM7) by cyclin/cyclin-dependent kinase affects its function in cell cycle regulation.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23318911 2013 The protein levels of MCM7 and p63 in evaluating lesion severity of cervical disease.
23313748 2013 Interaction of MCM7 and RACK1 for activation of MCM7 and cell growth.
23201130 2013 Multicenter validation of cyclin D1, MCM7, TRIM29, and UBE2C as prognostic protein markers in non-muscle-invasive bladder cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22967762 2012 Characterization of O-GlcNAc cycling and proteomic identification of differentially O-GlcNAcylated proteins during G1/S transition.
22918583 2012 The eukaryotic Mcm2-7 replicative helicase.
22784096 2012 MCM7 expression predicts post-operative prognosis for hepatocellular carcinoma.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22456526 2012 Prognostic significance of MCM7 expression in the bronchial brushings of patients with non-small cell lung cancer (NSCLC).
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21965782 2011 Immunohistochemical expression and prognostic significance of CCND3, MCM2 and MCM7 in Hodgkin lymhoma.
21619671 2011 Minichromosome Maintenance Protein 7 is a potential therapeutic target in human cancer and a novel prognostic marker of non-small cell lung cancer.
21478101 2010 Minichromosome maintenance (MCM) and AgNOR proteins expression in desmoid tumours: a tissue microarray analysis.
21269460 2011 Initial characterization of the human central proteome.
21078875 2011 Cyclin A promotes S-phase entry via interaction with the replication licensing factor Mcm7.
21076460 2011 Minichromosome maintenance protein 7 as a potential prognostic factor for progression-free survival in high-grade serous carcinomas of the ovary.
20661220 2010 Minichromosome maintenance proteins 2, 3 and 7 in medulloblastoma: overexpression and involvement in regulation of cell migration and invasion.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20388916 2010 Identification of the miR-106b~25 microRNA cluster as a proto-oncogenic PTEN-targeting intron that cooperates with its host gene MCM7 in transformation.
20236609 2010 Transcriptional induction of minichromosome maintenance protein 7 (Mcm7) in human cholangiocarcinoma cells treated with Clonorchis sinensis excretory-secretory products.
20098747 2010 Expanding the substantial interactome of NEMO using protein microarrays.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20048674 2010 Cell proliferation index determination by immunohistochemical detection of hCDC47 protein.
19946888 2010 Defining the membrane proteome of NK cells.
19834905 2009 Identification of molecular targets for selective elimination of TRAIL-resistant leukemia cells. From spots to in vitro assays using TOP15 charts.
19805216 2009 Assembly of the Cdc45-Mcm2-7-GINS complex in human cells requires the Ctf4/And-1, RecQL4, and Mcm10 proteins.
19696745 2009 MCM10 mediates RECQ4 association with MCM2-7 helicase complex during DNA replication.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19318354 2009 The minichromosome maintenance proteins 2-7 (MCM2-7) are necessary for RNA polymerase II (Pol II)-mediated transcription.
19189662 Expression of Mcm7 and Cdc6 in oral squamous cell carcinoma and precancerous lesions.
19150984 2009 Identification and functional analysis of a novel cyclin e/cdk2 substrate ankrd17.
19144445 2009 Expression of minichromosome maintenance 7 (MCM7) in small lung adenocarcinomas (pT1): Prognostic implication.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636144 2008 Minichromosome maintenance protein 7 in colorectal cancer: implication of prognostic significance.
18072282 2008 Colocalization of MCM8 and MCM7 with proteins involved in distinct aspects of DNA replication.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17557111 2007 Molecular architecture of the human GINS complex.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17310990 2007 Human INT6 interacts with MCM7 and regulates its stability during S phase of the cell cycle.
17296731 2007 Identification and characterization of a novel component of the human minichromosome maintenance complex.
17116885 2006 Tipin and Timeless form a mutually protective complex required for genotoxic stress resistance and checkpoint function.
17094475 Immunohistochemical evaluation of minichromosome maintenance protein 7 in astrocytoma grading.
16899510 2006 Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells.
16703398 2006 Involvement of c-myc-regulated genes in hepatocellular carcinoma related to genotype-C hepatitis B virus.
16438930 2006 Direct interaction between cohesin complex and DNA replication machinery.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289477 2005 The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication.
16247466 2006 MCM7 amplification and overexpression are associated with prostate cancer progression.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15720416 2005 Replicative MCM7 protein as a proliferation marker in endometrial carcinoma: a tissue microarray and clinicopathological analysis.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15654075 2005 Interaction of chromatin-associated Plk1 and Mcm7.
15635413 2005 Nucleolar proteome dynamics.
15538388 2004 Interaction between human MCM7 and Rad17 proteins is required for replication checkpoint signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232106 2004 Self-assembling protein microarrays.
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
15210935 2004 Minichromosome maintenance proteins are direct targets of the ATM and ATR checkpoint kinases.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14678972 2003 Comparative analysis of cervical cancer in women and in a human papillomavirus-transgenic mouse model: identification of minichromosome maintenance protein 7 as an informative biomarker for human cervical cancer.
14675634 2003 The human papillomavirus type 11 and 16 E6 proteins modulate the cell-cycle regulator and transcription cofactor TRIP-Br1.
14550576 2003 Conditional expression of MCM7 increases tumor growth without altering DNA replication activity.
14516785 2003 Expression of minichromosome maintenance proteins in vascular smooth muscle cells is ERK/MAPK dependent.
12853948 2003 The DNA sequence of human chromosome 7.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12771218 2003 A new member of the MCM protein family encoded by the human MCM8 gene, located contrapodal to GCD10 at chromosome band 20p12.3-13.
12694531 2003 Mammalian Mcm2/4/6/7 complex forms a toroidal structure.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12519773 2003 The cyclin D1-dependent kinase associates with the pre-replication complex and modulates RB.MCM7 binding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364596 2002 Human Mcm proteins at a replication origin during the G1 to S phase transition.
12207017 2002 Roles of Mcm7 and Mcm4 subunits in the DNA helicase activity of the mouse Mcm4/6/7 complex.
12045100 2002 DNA replication in eukaryotic cells.
11931757 2002 Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.
11861392 2002 Minichromosome maintenance protein MCM7 is a direct target of the MYCN transcription factor in neuroblastoma.
11095689 2000 The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.
11056214 2000 The MAT1 cyclin-dependent kinase-activating kinase (CAK) assembly/targeting factor interacts physically with the MCM7 DNA licensing factor.
10846177 2000 Human Cdc7-related kinase complex. In vitro phosphorylation of MCM by concerted actions of Cdks and Cdc7 and that of a criticial threonine residue of Cdc7 bY Cdks.
10748114 2000 Inhibition of Mcm4,6,7 helicase activity by phosphorylation with cyclin A/Cdk2.
10722676 2000 Stepwise regulated chromatin assembly of MCM2-7 proteins.
10649446 2000 Protein-protein interaction of FHL2, a LIM domain protein preferentially expressed in human heart, with hCDC47.
10567526 1999 Biochemical analysis of the intrinsic Mcm4-Mcm6-mcm7 DNA helicase activity.
10518787 1999 Human CDC45 protein binds to minichromosome maintenance 7 protein and the p70 subunit of DNA polymerase alpha.
10473096 1999 Minichromosome maintenance proteins as biological markers of dysplasia and malignancy.
10464337 1999 Cell cycle regulation of human CDC6 protein. Intracellular localization, interaction with the human mcm complex, and CDC2 kinase-mediated hyperphosphorylation.
10436018 1999 The Cdc6 nucleotide-binding site regulates its activity in DNA replication in human cells.
9852095 1998 E3-ubiquitin ligase/E6-AP links multicopy maintenance protein 7 to the ubiquitination pathway by a novel motif, the L2G box.
9714754 1998 Cloning and characterization of human MCM7 promoter.
9705868 1998 Human papillomavirus oncoprotein E6 binds to the C-terminal region of human minichromosome maintenance 7 protein.
9566894 1998 Negative regulation of DNA replication by the retinoblastoma protein is mediated by its association with MCM7.
9305914 1997 A DNA helicase activity is associated with an MCM4, -6, and -7 protein complex.
9223437 1997 Expression, nuclear localization and interactions of human MCM/P1 proteins.
9133452 1997 Immunolocalization of hCDC47 protein in normal and neoplastic human tissues and its relation to growth.
9110174 1997 Large-scale concatenation cDNA sequencing.
9099751 1997 In vivo interaction of human MCM heterohexameric complexes with chromatin. Possible involvement of ATP.
8798650 1996 Binding of human minichromosome maintenance proteins with histone H3.
8652665 1996 Cloning of a cDNA encoding a human homologue of CDC47, a member of the MCM family.
8631321 1996 Properties of the human nuclear protein p85Mcm. Expression, nuclear localization and interaction with other Mcm proteins.
8626784 1996 hCDC47, a human member of the MCM family. Dissociation of the nucleus-bound form during S phase.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8265339 1993 The P1 family: a new class of nuclear mammalian proteins related to the yeast Mcm replication proteins.
8258304 1994 The human gene for nuclear protein BM28 (CDCL1), a new member of the early S-phase family of proteins, maps to chromosome band 3q21.
7842741 1995 Isolation and mapping of a human gene (MCM2) encoding a product homologous to yeast proteins involved in DNA replication.
7601140 1995 A human homologue of the yeast replication protein Cdc21. Interactions with other Mcm proteins.
1710453 1991 Nuclear matrix protein mitotin messenger RNA is expressed at constant levels during the cell cycle.