Property Summary

NCBI Gene PubMed Count 33
PubMed Score 58.03
PubTator Score 40.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 2.081 9.6e-06
ependymoma 1.200 1.5e-03
atypical teratoid / rhabdoid tumor 1.500 5.5e-04
glioblastoma 1.900 8.7e-03
group 4 medulloblastoma 1.700 8.0e-04
medulloblastoma, large-cell 2.300 1.5e-05
colon cancer 1.300 2.6e-02
pediatric high grade glioma 1.400 9.8e-03
aldosterone-producing adenoma -1.206 2.1e-02
ovarian cancer 2.200 8.2e-07
Gaucher disease type 1 -1.800 4.9e-03

Gene RIF (18)

PMID Text
26749495 These results indicated that the GANP protein is associated with breast cancer resistance.
24198285 GANP is induced in activated T4 cells & physically interacts with A3G. GANP is encapsidated in HIV-1 virions & modulates A3G packaging into the cores. Upregulation increases A3G-catalyzed viral G-->A hypermutation, suppressing infectivity.
24198285 Encapsidation of GANP into virions requires the CA region of HIV-1 Gag and GANP and is associated with HIV-1 genomic RNA
24123876 A homozygous potentially pathogenic variant (c.2743G>A) was identified, which encodes amino acid Lys, instead of conserved Glu, at the position 915, in patients with mild intellectual disability.
23652018 GANP-mediated chromatin modification promotes transcription complex recruitment and positioning at immunoglobulin variable loci to favour AID targeting.
23094019 The cellular protein MCM3AP is required for inhibition of cellular DNA synthesis by the IE86 protein of human cytomegalovirus.
22942428 GANP transgene may play a critical role in Lyn tyrosine-protein kinase-mediated signaling during selection of high-affinity B cells in peripheral lymphoid organs.
22395445 GANP, a homologue of yeast Sac3 that is involved in mRNA export, is indispensable for ensuring the stability of human genomic DNA and GANP knockdown causes apoptosis and necrosis of p53-insufficient cancer cells.
21195085 MCM3AP and GANP are different proteins, occupying different locations in the cell and transcribed from different promoters
20714864 HBV DNA integration sites into human genome were random, and MCM3AP was a new site.
20507984 GANP may serve as an essential link required to transport AID to B-cell nuclei and to target AID to actively transcribed IgV regions
20384790 Data show that human germinal center-associated nuclear protein (GANP) is critically involved in cell proliferation at the mitotic phase through its selective support of shugoshin-1 mRNA export.
20005110 GANP depletion inhibits mRNA export, with retention of mRNPs and NXF1 in punctate foci within the nucleus.
19686285 GANP protects cells from cellular senescence caused by DNA damage and that a significant decrease in GANP expression leads to malignancy by generating hyperploidy and chromosomal instability (CIN).
19578742 abnormal over-expression of GANP together with AID might be associated with rigorous DNA damage, potentially causing the malignant development of Cholangiocarcinoma (CCAs) during long-term inflammation.
18976975 Knockdown of minichromosome maintenance complex component 3 associated protein (MCM3AP) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12885157 plays a certain important role in the maturation of immunoglobulin or selection of B cells in germinal centers during the immune response to TD-Ag. A selective function of GANP molecule on B cell proliferation and differentiation might exist.
12226073 inhibits initiation of DNA replication via binding to MCM3

AA Sequence

MNPTNPFSGQQPSAFSASSSNVGTLPSKPPFRFGQPSLFGQNSTLSGKSSGFSQVSSFPASSGVSHSSSV      1 - 70
QTLGFTQTSSVGPFSGLEHTSTFVATSGPSSSSVLGNTGFSFKSPTSVGAFPSTSAFGQEAGEIVNSGFG     71 - 140
KTEFSFKPLENAVFKPILGAESEPEKTQSQIASGFFTFSHPISSAPGGLAPFSFPQVTSSSATTSNFTFS    141 - 210
KPVSSNNSLSAFTPALSNQNVEEEKRGPKSIFGSSNNSFSSFPVSSAVLGEPFQASKAGVRQGCEEAVSQ    211 - 280
VEPLPSLMKGLKRKEDQDRSPRRHGHEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNK    281 - 350
EVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRS    351 - 420
ESTDSLGGLSPSEVTAIQCKNIPDYLNDRTILENHFGKIAKVQRIFTRRSKKLAVVHFFDHASAALARKK    421 - 490
GKSLHKDMAIFWHRKKISPNKKPFSLKEKKPGDGEVSPSTEDAPFQHSPLGKAAGRTGASSLLNKSSPVK    491 - 560
KPSLLKAHQFEGDSFDSASEGSEGLGPCVLSLSTLIGTVAETSKEKYRLLDQRDRIMRQARVKRTDLDKA    561 - 630
RTFVGTCLDMCPEKERYMRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRT    631 - 700
MDYLVTQIMDQKEGSLRDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSF    701 - 770
DAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPAVRNSSEVKFA    771 - 840
VQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDALRALNFAYTVSTQRSTIFPLDGVVRMLLF    841 - 910
RDCEEATDFLTCHGLTVSDGCVELNRSAFLEPEGLSKTRKSVFITRKLTVSVGEIVNGGPLPPVPRHTPV    911 - 980
CSFNSQNKYIGESLAAELPVSTQRPGSDTVGGGRGEECGVEPDAPLSSLPQSLPAPAPSPVPLPPVLALT    981 - 1050
PSVAPSLFQLSVQPEPPPPEPVPMYSDEDLAQVVDELIQEALQRDCEEVGSAGAAYAAAALGVSNAAMED   1051 - 1120
LLTAATTGILRHIAAEEVSKERERREQERQRAEEERLKQERELVLSELSQGLAVELMERVMMEFVRETCS   1121 - 1190
QELKNAVETDQRVRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQM   1191 - 1260
RAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHAGRLGISCTRLRRLRNKTAHQMKVQHFYQ   1261 - 1330
QLLSDVAWASLDLPSLVAEHLPGRQEHVFWKLVLVLPDVEEQSPESCGRILANWLKVKFMGDEGSVDDTS   1331 - 1400
SDAGGIQTLSLFNSLSSKGDQMISVNVCIKVAHGALSDGAIDAVETQKDLLGASGLMLLLPPKMKSEDMA   1401 - 1470
EEDVYWLSALLQLKQLLQAKPFQPALPLVVLVPSPGGDAVEKEVEDGLMLQDLVSAKLISDYTVTEIPDT   1471 - 1540
INDLQGSTKVLQAVQWLVSHCPHSLDLCCQTLIQYVEDGIGHEFSGRFFHDRRERRLGGLASQEPGAIIE   1541 - 1610
LFNSVLQFLASVVSSEQLCDLSWPVTEFAEAGGSRLLPHLHWNAPEHLAWLKQAVLGFQLPQMDLPPLGA   1611 - 1680
PWLPVCSMVVQYASQIPSSRQTQPVLQSQVENLLHRTYCRWKSKSPSPVHGAGPSVMEIPWDDLIALCIN   1681 - 1750
HKLRDWTPPRLPVTSEALSEDGQICVYFFKNDLKKYDVPLSWEQARLQTQKELQLREGRLAIKPFHPSAN   1751 - 1820
NFPIPLLHMHRNWKRSTECAQEGRIPSTEDLMRGASAEELLAQCLSSSLLLEKEENKRFEDQLQQWLSED   1821 - 1890
SGAFTDLTSLPLYLPQTLVSLSHTIEPVMKTSVTTSPQSDMMREQLQLSEATGTCLGERLKHLERLIRSS   1891 - 1960
REEEVASELHLSALLDMVDI                                                     1961 - 1980
//

Text Mined References (41)

PMID Year Title
26749495 2016 GANP protein encoded on human chromosome 21/mouse chromosome 10 is associated with resistance to mammary tumor development.
24198285 2013 GANP interacts with APOBEC3G and facilitates its encapsidation into the virions to reduce HIV-1 infectivity.
24123876 2013 Identification of pathogenic gene variants in small families with intellectually disabled siblings by exome sequencing.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23652018 2013 GANP regulates recruitment of AID to immunoglobulin variable regions by modulating transcription and nucleosome occupancy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23094019 2012 The cellular protein MCM3AP is required for inhibition of cellular DNA synthesis by the IE86 protein of human cytomegalovirus.
22942428 2012 Lyn signaling to upregulate GANP is critical for the survival of high-affinity B cells in germinal centers of lymphoid organs.
22395445 2012 Selective cell death of p53-insufficient cancer cells is induced by knockdown of the mRNA export molecule GANP.
22307388 2012 Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21195085 2011 MCM3AP is transcribed from a promoter within an intron of the overlapping gene for GANP.
20714864 2010 MCM3AP, a novel HBV integration site in hepatocellular carcinoma and its implication in hepatocarcinogenesis.
20507984 2010 GANP-mediated recruitment of activation-induced cytidine deaminase to cell nuclei and to immunoglobulin variable region DNA.
20384790 2010 Germinal center-associated nuclear protein (GANP) is involved in mRNA export of Shugoshin-1 required for centromere cohesion and in sister-chromatid exchange.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20005110 2010 mRNA export from mammalian cell nuclei is dependent on GANP.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19686285 2009 Decreased expression of germinal center-associated nuclear protein is involved in chromosomal instability in malignant gliomas.
19578742 2009 Cholangiocarcinomas associated with long-term inflammation express the activation-induced cytidine deaminase and germinal center-associated nuclear protein involved in immunoglobulin V-region diversification.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16914116 2006 Functional interaction between the glucocorticoid receptor and GANP/MCM3AP.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12885157 2002 Involvement of GANP in B cell activation in T cell-dependent antigen response.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12226073 2002 The MCM3 acetylase MCM3AP inhibits initiation, but not elongation, of DNA replication via interaction with MCM3.
12167160 2002 MCM3-binding GANP DNA-primase is associated with a novel phosphatase component G5PR.
11641399 2001 PU.1 is involved in the regulation of B lineage-associated and developmental stage-dependent expression of the germinal center-associated DNA primase GANP.
11526238 2001 Germinal center-associated nuclear protein (GANP) has a phosphorylation-dependent DNA-primase activity that is up-regulated in germinal center regions.
11258703 2001 MCM3AP, a novel acetyltransferase that acetylates replication protein MCM3.
11024281 2000 Structure, expression, and chromosomal localization of the human gene encoding a germinal center-associated nuclear protein (GANP) that associates with MCM3 involved in the initiation of DNA replication.
10830953 2000 The DNA sequence of human chromosome 21.
10733502 2000 A novel nuclear phosphoprotein, GANP, is up-regulated in centrocytes of the germinal center and associated with MCM3, a protein essential for DNA replication.
9712829 1998 Identification of a novel MCM3-associated protein that facilitates MCM3 nuclear localization.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.