Property Summary

NCBI Gene PubMed Count 135
PubMed Score 233.01
PubTator Score 225.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 2.700 7.1e-09
psoriasis 2.000 1.6e-04
glioblastoma 2.700 1.1e-05
oligodendroglioma 1.100 6.9e-07
posterior fossa group A ependymoma 2.000 3.9e-08
sonic hedgehog group medulloblastoma 3.400 2.4e-09
atypical teratoid/rhabdoid tumor 3.100 5.4e-11
medulloblastoma, large-cell 3.500 3.8e-07
primitive neuroectodermal tumor 2.700 3.4e-05
adrenocortical carcinoma 1.817 1.6e-05
non-small cell lung cancer 2.976 2.2e-32
intraductal papillary-mucinous carcinoma... 1.600 9.5e-04
intraductal papillary-mucinous neoplasm ... 2.000 1.5e-03
colon cancer 1.200 3.3e-02
lung cancer 2.800 1.4e-05
pediatric high grade glioma 2.700 8.0e-08
nasopharyngeal carcinoma 1.400 2.0e-06
lung adenocarcinoma 1.109 1.1e-03
Endometriosis 1.096 5.0e-02
Breast cancer 1.400 9.7e-09
ductal carcinoma in situ 1.200 2.0e-02
invasive ductal carcinoma 1.700 1.7e-03
ovarian cancer 1.800 1.0e-04
pituitary cancer 1.100 5.0e-06

Gene RIF (85)

PMID Text
26889980 MCM2 expression is higher in ovarian and endometrial high-grade serous carcinomas (HGSC) than in ovarian or endometrial endometrioid carcinoma. Knockdown in ovarian HGSC cell line decreased cell proliferation.
26712671 The findings indicated that Mcm-2 could be a useful marker for early detection of oral squamous cell carcinoma
26549452 PTEN regulates DNA replication through MCM2 and loss of PTEN function leads to replication defects and genomic instability.
26196677 MCM2 is a novel gene responsible for nonsyndromic hearing loss of autosomal dominant inheritance in a Chinese family.
26186914 quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
26167883 Data indicate that minichromosome maintenance protein 2 (MCM2) binding is not required for incorporation of histone H3.1-H4 into chromatin but is important for stability of H3.1-H4.
25755789 minichromosome maintenance protein-2 may serve as a useful marker in the screening of cervical carcinoma and precancerous lesions and improve the diagnosis of atypical squamous cell of undetermined significance
25738322 MCM2 may be a novel therapeutic target of lovastatin treatment in NSCLCs.
25618846 Thermodynamic analysis of the quaternary complex together with structural modeling support that ASF1 and MCM2 could form a chaperoning module for histones H3 and H4 protecting them from promiscuous interactions.
25046975 Results show that in Glioma patients, MCM 2, MCM3 and MCM7 mRNA are up-regulated and correlated with poor outcome.
24970811 Data suggest that minichromosome maintenance complex component 2 (MCM2) is a likely target gene of microRNA-31.
24706378 The data suggest that MCM2 is not a good biomarker when comparing the different clinical stages of cervical cancer.
24630889 MCM2/TOP2A immunohistochemistry can help to support a diagnosis of true dysplasia for patients without a history of head and neck cancer.
24386425 Of the total, the deregulation of several genes (CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a and RPN2) were potentially associated with disease development and progression.
23803736 ORC/Cdc6/MCM2-7 complex is a new regulatory mechanism for the helicase.
23770000 MCM-2 is a therapeutic target of Trichostatin A in colon cancer cells.
23364796 HIV-1 Tat upregulates the expression of minichromosome maintenance complex component 2 (MCM2) in Jurkat cells
23347057 Mcm2 expression and DNA ploidy analysis could be used to predict areas of malignant transformation in oral proliferative verrucous leukoplakia.
23329420 MCM2 is a sensitive, specific and efficient biomarker of gastric cardiac cancer having potential use in the clinic.
22918583 Mcm2-7 loads onto origins during initiation as a double hexamer, yet does not act as a double-stranded DNA pump during elongation.
22778705 The results of this study indicated that the higher MCM-2 expressions in RC than the KCOT might be related to the inflammation and this protein might be more sensitive to inflammation.
22590819 ProEx C showed the best specificity; p16 displayed the highest sensitivity and area under receiver operating characteristic curve for squamous intraepithelial lesions diagnosis.
22554381 Immunohistochemical expression of minichromosome maintenance complex protein 2 predicts biochemical recurrence in prostate cancer.
22474384 Data show that using a 200-nt primed circular DNA substrate, the combined action of DNA polymerase epsilon and the Cdc45/Mcm2-7/GINS (CMG complex) leads to the formation of products >10 kb in length.
22115939 The up-regulated expression of MCM2 is associated with frequent apoptosis in myelodysplastic syndromes (MDS) and may have an important role in the pathogenesis of MDS.
21965782 Lymph node sections from 138 HL patients were immunohistochemically stained for cyclin D3 (CCND3), MCM2 and MCM7 aiming to investigate clinical outcome.
21947329 Our data suggest that MCM2 could serve as a novel prognostic biomarker in gastric carcinoma.
21943228 Salivary gland carcinomas express maspin and MCM2 with variable levels and cellular localization
21868554 MT-I/II may play a key role in IDC proliferation, but is not a useful prognostic factor of this disease
21868526 evaluated the intensity of metallothionein expression in various histological types of non-small cell lung cancer and correlated expression intensity with pathological parameters and Ki-67 and minichromosome maintaince protein 2 proliferation markers
21866463 MCM2 is a promising prognostic factor in wilm's tumor treated according to the SIOP scheme
21775519 These results suggest that HERC2 regulates DNA replication progression and origin firing by facilitating MCM2 phosphorylation.
21543106 overexpression of MCM2 or loss of expression of Tat-interacting protein 30 is closely related to carcinogenesis, progression, biological behavior, and prognosis of gallbladder adenocarcinoma.
21478101 lack of MCM2, proteins expression which may explain commonly known low mitotic activity of desmoid tumour cells
21457648 Study shows that despite the predominantly different localization of MCM 2 and replication signals, there is still a small but significant fraction of MCM 2 proteins that co-localize with DNA replication foci during most of S phase.
21237484 Minichromosome maintenance protein 2 is more sensitive and specific than proliferating cell nuclear antigen and Ki67 in indicating esophageal dysplasia.
21097442 study demonstrated a positive correlation between expressions of Ki-67 and MCM-2 in ductal breast cancers; most intense expression of these two markers was demonstrated in G3 grade cancers
20847638 Suggest that MCM 2 protein is a reliable marker for diagnosing and grading actinic keratosis and further could be hypothesized as an important prognostic factor.
20697251 MCM2 is a component of the minichromosome maintenance (MCM) complex, which is essential for the initiation and elongation of DNA during replication in eukaryotic cells.
20694513 MCM-2 expression did not show significant associations with any clinicopathological parameters, while Ki-67 expression was merely significantly associated with tumor size. Neither MCM-2 nor Ki-67 expression had significant prognostic value.
20661220 deregulation of MCM2, MCM3 and MCM7 expression might be involved in medulloblastoma tumorigenesis
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
20333247 the ability of cytomegalovirus to delay the accumulation of the mini-chromosome maintenance (MCM) complex proteins, represented by MCM2 and MCM4, and prevent their loading onto chromatin, was compromised in the absence of pUL117
20184667 ProExC expression is not associated with HPV in squamous cell carcinoma in situ of the skin
20174894 Mcm2 index showed a significant association with pituitary tumor extension (p = 0.02), but not with tumor invasion.
19805216 interactions between Cdc45, Mcm2-7, and the GINS complex (collectively called the CMG complex), which seem to play a key role in the formation and progression of replication forks
19696745 Replisome factors MCM10, MCM2and MCM7 helicase, are the primary interaction partner proteins of human RECQ4.
19647517 Phosphorylation of Mcm2 by Cdc7 kinase promotes chromatin loading of Mcm2.
19522849 MCM2 does not appear useful in differentiating basal cell carcinomas with follicular differentiation from trichoepitheliomas
19318354 the MCM2-7 proteins are co-localized with RNA Pol II on chromatins of constitutively transcribing genes, and MCM5 is required for transcription elongation of RNA Pol II.
19243005 Lymphocyte Mcm-2 expression is a useful adjunct to histology in differentiating between hepatitis C virus graft infection and acute cellular rejection.
19144445 MCM7 is a more reliable marker than MCM2 or Ki-67 in lung adenocarcinomas
19077563 The potential value of MCM2 in early diagnosis of colorectal cancer.
19001876 absence of multiple MCM2 transcripts implied a possible posttranslational molecular cleavage in generation of the MCM2-related fragment, and a potential functional role in the regulation of the activity of the MCM protein complex.
19001846 MCM-2 fragment is upregulated in senescence, quiescence, and differentiation
18803052 MCM2 expression was observed in the basal third to half of the colonic crypts in normal mucosa, but throughout colonic adenocarcinoma and adenoma epithelia. However, expression of MCM2 in adenocarcinomas was significantly higher than in adenomas.
18774496 Minichromosome maintenance protein 2 is a useful proliferative marker of breast carcinoma.
18465232 In colon cancer, MCM2 expression was associated with the tumors' histological grade, existence of nodular metastases, malignancy on adenoma, and vascular invasion.
18286467 Cdc7/Dbf4 kinase activity inhibition affects specific phosphorylation sites on MCM2 in cancer cells
18249467 MCM protein 2 is present in melanocytes from benign nevi, dysplastic nevi, primary cutaneous melanomas, and cutaneous melanoma metastases.
18248354 may be a sensitive proliferation marker in salivary gland tumours
18190532 Results strongly suggest that the MCM2 fragments derived from the C-terminal region inhibit DNA helicase activity through their ability to bind to ssDNA.
18184650 exogenous Cdt1 induces re-replication by de-repressing endogenous Cdt1 through the titration of PCNA and cyclin; Cdt1 lacking the evolutionarily conserved region that interacts with MCM2-7 is capable of inducing re-replication
17940502 MCM-2 and MCM-5 proteins appear to be promising as prognostic markers in patients with ovarian adenocarcinomas.
17557111 MCM2 is part of the GINS complex.
17512033 Immunoreactivity for p16, MCM2, and TOP IIA was detected in only 76% of cases in low-grade squamous intraepitelial lesions (LSIL).
16899510 Taken together, these results indicate that Cdc7/Dbf4 phosphorylation of MCM2 is essential for the initiation of DNA replication in mammalian cells.
16882345 higher expression in MCM2 and gelsolin was significantly associated with poorer prognosis in patients with NSCLC, which suggests that higher tumor proliferation and motility may be important in the prognosis of NSCLC
16864800 Results describe the mapping of the sites in human Mcm2 protein that are phosphorylated by Cdc7.
16722928 MCM2 is a helpful marker for differentiating follicular carcinoma and follicular adenoma of the thyroid.
16629645 The combination of MCM2, geminin and Ki67 could represent a valuable tool in the understanding of hepatocellular carcinoma progression in cirrhosis.
16609045 The MCM2 protein expression was associated with the highest levels of proliferation, suggesting a synergistic effect.
16446360 the majority of the Mcm2 isoforms phosphorylated by Cdc7 are not stably associated with chromatin
15766559 purified hRad51 and hRad52 interact with each other as well as with Mini chromosome maintenance (MCM) proteins in HeLa cell extracts
15236977 pairwise interactions of individual human MCM subunits by using the yeast two-hybrid system and in vivo protein-protein crosslinking
15210935 ATM/ATR-dependent (ataxia-telangiectasia-mutated/ATM- and Rad3-related) checkpoint pathways are directly linked to three members of the MCM complex(MCM2,MCM3,MCM7).
12966424 Increased expression of minichromosome maintenance protein-2 and Ki67 is associated with laryngeal squamous epithelial lesions
12740381 role of AKAP95 in DNA replication by providing a scaffold for MCM2
12119552 MCM2 expression in fibrous histiocytoma correlates with cell proliferation.Its expression is ubiquitous in proliferating cells, regardless of the expression of P53. MCM2 might be a reliable marker of proliferating cells in human MFH.
12087101 Functional analysis of the Xenopus homolog
11872961 MCM2(Minichromosome Maintenance 2) is regulated via a P53-independent pathway, and a useful biomarker of proliferating cells.
11864598 Functional analysis of the Xenopus homolog
11568184 Functional analysis of the mouse homolog
11472637 MCM2 is a sensitive marker for premalignant lung cells since it is present in cells at the surface of metaplastic lung lesions, which are more likely to be exfoliated into sputum.

AA Sequence

MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGE      1 - 70
ELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDREAGRGLGRMRRGLLYDSD     71 - 140
EEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSH    141 - 210
GHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNH    211 - 280
IHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPG    281 - 350
SCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN    351 - 420
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHED    421 - 490
IKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYV    491 - 560
QRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAA    561 - 630
NPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGS    631 - 700
AAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESM    701 - 770
IRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV    771 - 840
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF          841 - 904
//

Text Mined References (153)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26889980 2016 Similar protein expression profiles of ovarian and endometrial high-grade serous carcinomas.
26712671 2015 Minichromosome maintenance-2 (MCM2) expression differentiates oral squamous cell carcinoma from pre-cancerous lesions.
26549452 2015 PTEN Controls the DNA Replication Process through MCM2 in Response to Replicative Stress.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26196677 2015 Whole Exome Sequencing Identified MCM2 as a Novel Causative Gene for Autosomal Dominant Nonsyndromic Deafness in a Chinese Family.
26186914 2015 Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2.
26167883 2015 A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
25755789 2015 Diagnostic value of MCM2 immunocytochemical staining in cervical lesions and its relationship with HPV infection.
25738322 2015 MCM2 is a therapeutic target of lovastatin in human non-small cell lung carcinomas.
25618846 2015 Structural insight into how the human helicase subunit MCM2 may act as a histone chaperone together with ASF1 at the replication fork.
25416956 2014 A proteome-scale map of the human interactome network.
25046975 2014 Minichromosome Maintenance (MCM) Family as potential diagnostic and prognostic tumor markers for human gliomas.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24970811 2014 MicroRNA-31 suppresses medulloblastoma cell growth by inhibiting DNA replication through minichromosome maintenance 2.
24706378 2014 Correlation of MCM2 detection with stage and virology of cervical cancer.
24630889 2014 MCM2/TOP2A (ProExC) immunohistochemistry as a predictive marker in head and neck mucosal biopsies.
24386425 2013 Microarray gene expression analysis of tumorigenesis and regional lymph node metastasis in laryngeal squamous cell carcinoma.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23803736 2013 The ORC/Cdc6/MCM2–7 complex, a new power player for regulated helicase loading.
23770000 2013 MCM-2 is a therapeutic target of Trichostatin A in colon cancer cells.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23347057 2013 High incidence of DNA ploidy abnormalities and increased Mcm2 expression may predict malignant change in oral proliferative verrucous leukoplakia.
23329420 2013 MCM2 expression levels predict diagnosis and prognosis in gastric cardiac cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22918583 2012 The eukaryotic Mcm2-7 replicative helicase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22778705 2012 Ki-67 and MCM-2 in dental follicle and odontogenic cysts: the effects of inflammation on proliferative markers.
22590819 2012 Analysis of performance characteristics of five cell cycle-related immunohistochemical markers and human papillomavirus genotyping in the diagnosis of cervical squamous cell carcinoma precursor lesions.
22554381 2012 Immunohistochemical expression of minichromosome maintenance complex protein 2 predicts biochemical recurrence in prostate cancer: a tissue microarray and digital imaging analysis-based study of 428 cases.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22474384 2012 Properties of the human Cdc45/Mcm2-7/GINS helicase complex and its action with DNA polymerase epsilon in rolling circle DNA synthesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22115939 2012 Overexpression of MCM2 in myelodysplastic syndromes: association with bone marrow cell apoptosis and peripheral cytopenia.
21965782 2011 Immunohistochemical expression and prognostic significance of CCND3, MCM2 and MCM7 in Hodgkin lymhoma.
21947329 2012 Overexpression of minichromosome maintenance 2 predicts poor prognosis in patients with gastric cancer.
21943228 2011 Maspin and MCM2 immunoprofiling in salivary gland carcinomas.
21868554 2011 Correlation of intensity of MT-I/II expression with Ki-67 and MCM-2 proteins in invasive ductal breast carcinoma.
21868526 2011 Correlation between expression of metallothionein and expression of Ki-67 and MCM-2 proliferation markers in non-small cell lung cancer.
21866463 2011 Minichromosome maintenance 2 (MCM2) is a new prognostic proliferative marker in Wilms tumour.
21775519 2011 HERC2 Interacts with Claspin and regulates DNA origin firing and replication fork progression.
21543106 2011 Clinicopathologic significance of minichromosome maintenance protein 2 and Tat-interacting protein 30 expression in benign and malignant lesions of the gallbladder.
21478101 2010 Minichromosome maintenance (MCM) and AgNOR proteins expression in desmoid tumours: a tissue microarray analysis.
21457648 2011 A fraction of MCM 2 proteins remain associated with replication foci during a major part of S phase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21237484 2011 Potential role of minichromosome maintenance protein 2 as a screening biomarker in esophageal cancer high-risk population in China.
21097442 2010 Correlation of Ki-67 and MCM-2 proliferative marker expression with grade of histological malignancy (G) in ductal breast cancers.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20847638 2010 Minichromosome maintenance protein expression according to the grade of atypism in actinic keratosis.
20697251 2010 Immunohistochemical patterns of ProEx C in vulvar squamous lesions: detection of overexpression of MCM2 and TOP2A.
20694513 2011 MCM-2 and MCM-5 expression in gastric adenocarcinoma: clinical significance and comparison with Ki-67 proliferative marker.
20661220 2010 Minichromosome maintenance proteins 2, 3 and 7 in medulloblastoma: overexpression and involvement in regulation of cell migration and invasion.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20333247 2010 Human cytomegalovirus protein pUL117 targets the mini-chromosome maintenance complex and suppresses cellular DNA synthesis.
20184667 2010 Expression profiles of ProEx C and Ki67 in squamous cell carcinoma in situ of the skin and their relationship with human papillomavirus genotypes.
20174894 2010 Determination of cell proliferation using Mcm2 antigen and evaluation of apoptosis and TGF-beta1 expression in GH-secreting or clinically nonfunctioning pituitary adenomas.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19862764 2009 Analysis of interaction partners of H4 histone by a new proteomics approach.
19819239 2009 The interaction between EAP30 and ELL is modulated by MCM2.
19805216 2009 Assembly of the Cdc45-Mcm2-7-GINS complex in human cells requires the Ctf4/And-1, RecQL4, and Mcm10 proteins.
19696745 2009 MCM10 mediates RECQ4 association with MCM2-7 helicase complex during DNA replication.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19647517 2009 Phosphorylation of Mcm2 by Cdc7 promotes pre-replication complex assembly during cell-cycle re-entry.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19522849 2009 MCM 2 Expression in Basal Cell Carcinomas and Trichoepitheliomas.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19318354 2009 The minichromosome maintenance proteins 2-7 (MCM2-7) are necessary for RNA polymerase II (Pol II)-mediated transcription.
19243005 2009 Minichromosome maintenance protein-2-positive portal tract lymphocytes distinguish acute cellular rejection from hepatitis C virus recurrence after liver transplantation.
19144445 2009 Expression of minichromosome maintenance 7 (MCM7) in small lung adenocarcinomas (pT1): Prognostic implication.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19077563 2009 mRNA expression of minichromosome maintenance 2 in colonic adenoma and adenocarcinoma.
19001876 2008 Cleavage of MCM2 licensing protein fosters senescence in human keratinocytes.
19001846 2008 A novel MCM-2 fragment with potential biological function in senescence.
18803052 2008 [Expression of minichromosome maintenance protein 2 in colonic adenocarcinoma, adenoma and normal colonic mucosa and its clinical significance].
18774496 2008 Minichromosome maintenance protein 2 is a reliable proliferative marker in breast carcinoma.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18465232 2009 Clinical significance of MCM-2 and MCM-5 expression in colon cancer: association with clinicopathological parameters and tumor proliferative capacity.
18286467 2008 Inhibition of Cdc7/Dbf4 kinase activity affects specific phosphorylation sites on MCM2 in cancer cells.
18249467 2008 Minichromosome maintenance protein expression in benign nevi, dysplastic nevi, melanoma, and cutaneous melanoma metastases.
18248354 2008 Expression of Mcm-2, Ki-67 and geminin in benign and malignant salivary gland tumours.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18190532 2008 Biochemical characterization of fragmented human MCM2.
18184650 2008 Human Cdt1 lacking the evolutionarily conserved region that interacts with MCM2-7 is capable of inducing re-replication.
17940502 2007 Minichromosome maintenance proteins 2 and 5 in non-benign epithelial ovarian tumours: relationship with cell cycle regulators and prognostic implications.
17557111 2007 Molecular architecture of the human GINS complex.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17512033 2007 Evaluation of p16INK4a, minichromosome maintenance protein 2, DNA topoisomerase IIalpha, ProEX C, and p16INK4a/ProEX C in cervical squamous intraepithelial lesions.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17296731 2007 Identification and characterization of a novel component of the human minichromosome maintenance complex.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17062569 2007 Cdc7 is an active kinase in human cancer cells undergoing replication stress.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16899510 2006 Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells.
16882345 2006 Prognostic significance of MCM2, Ki-67 and gelsolin in non-small cell lung cancer.
16864800 2006 CDC7 kinase phosphorylates serine residues adjacent to acidic amino acids in the minichromosome maintenance 2 protein.
16722928 2006 Cell proliferation marker MCM2, but not Ki67, is helpful for distinguishing between minimally invasive follicular carcinoma and follicular adenoma of the thyroid.
16629645 2006 Novel markers of cell kinetics to evaluate progression from cirrhosis to hepatocellular carcinoma.
16609045 2006 Analysis of c-ErbB1/epidermal growth factor receptor and c-ErbB2/HER-2 expression in bronchial dysplasia: evaluation of potential targets for chemoprevention of lung cancer.
16446360 2006 Identification of Mcm2 phosphorylation sites by S-phase-regulating kinases.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15766559 2005 Interaction of hRad51 and hRad52 with MCM complex: a cross-talk between recombination and replication proteins.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15654075 2005 Interaction of chromatin-associated Plk1 and Mcm7.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15236977 2004 Pairwise interactions of the six human MCM protein subunits.
15232106 2004 Self-assembling protein microarrays.
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
15210935 2004 Minichromosome maintenance proteins are direct targets of the ATM and ATR checkpoint kinases.
12966424 2003 Aberrant expression of minichromosome maintenance protein-2 and Ki67 in laryngeal squamous epithelial lesions.
12805274 2003 Identification of promoter regions in the human genome by using a retroviral plasmid library-based functional reporter gene assay.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12740381 2003 Protein kinase A-anchoring protein AKAP95 interacts with MCM2, a regulator of DNA replication.
12694531 2003 Mammalian Mcm2/4/6/7 complex forms a toroidal structure.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12480933 2003 Reconstitution of the Mcm2-7p heterohexamer, subunit arrangement, and ATP site architecture.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392551 2002 Distinct parts of minichromosome maintenance protein 2 associate with histone H3/H4 and RNA polymerase II holoenzyme.
12207017 2002 Roles of Mcm7 and Mcm4 subunits in the DNA helicase activity of the mouse Mcm4/6/7 complex.
12119552 2002 Expression of minichromosome maintenance-2 in human malignant fibrous histiocytomas: Correlations with Ki-67 and P53 expression, and apoptosis.
12087101 2002 MCM2-7 complexes bind chromatin in a distributed pattern surrounding the origin recognition complex in Xenopus egg extracts.
12045100 2002 DNA replication in eukaryotic cells.
11931757 2002 Human origin recognition complex large subunit is degraded by ubiquitin-mediated proteolysis after initiation of DNA replication.
11864598 2002 Xenopus Mcm10 binds to origins of DNA replication after Mcm2-7 and stimulates origin binding of Cdc45.
11568184 2001 Biochemical activities associated with mouse Mcm2 protein.
11472637 2001 MCM2--a promising marker for premalignant lesions of the lung: a cohort study.
11278932 2001 Replication factors MCM2 and ORC1 interact with the histone acetyltransferase HBO1.
11095689 2000 The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.
10846177 2000 Human Cdc7-related kinase complex. In vitro phosphorylation of MCM by concerted actions of Cdks and Cdc7 and that of a criticial threonine residue of Cdc7 bY Cdks.
10748114 2000 Inhibition of Mcm4,6,7 helicase activity by phosphorylation with cyclin A/Cdk2.
10567526 1999 Biochemical analysis of the intrinsic Mcm4-Mcm6-mcm7 DNA helicase activity.
10523313 1999 Mammalian Cdc7-Dbf4 protein kinase complex is essential for initiation of DNA replication.
10436018 1999 The Cdc6 nucleotide-binding site regulates its activity in DNA replication in human cells.
9642275 1998 Cell cycle- and chromatin binding state-dependent phosphorylation of human MCM heterohexameric complexes. A role for cdc2 kinase.
9305914 1997 A DNA helicase activity is associated with an MCM4, -6, and -7 protein complex.
8798650 1996 Binding of human minichromosome maintenance proteins with histone H3.
8258304 1994 The human gene for nuclear protein BM28 (CDCL1), a new member of the early S-phase family of proteins, maps to chromosome band 3q21.
8175912 1994 A human nuclear protein with sequence homology to a family of early S phase proteins is required for entry into S phase and for cell division.
7842741 1995 Isolation and mapping of a human gene (MCM2) encoding a product homologous to yeast proteins involved in DNA replication.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.
1710453 1991 Nuclear matrix protein mitotin messenger RNA is expressed at constant levels during the cell cycle.