Property Summary

NCBI Gene PubMed Count 146
PubMed Score 246.01
PubTator Score 225.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 1.817 1.6e-05
adult high grade glioma 2.400 8.3e-05
atypical teratoid / rhabdoid tumor 3.000 1.1e-08
Breast cancer 1.400 9.7e-09
colon cancer 1.200 3.3e-02
ductal carcinoma in situ 1.200 2.0e-02
Endometriosis 1.096 5.0e-02
ependymoma 1.700 1.4e-09
glioblastoma 2.500 1.3e-09
group 3 medulloblastoma 3.200 3.0e-07
intraductal papillary-mucinous carcinoma... 1.600 9.5e-04
intraductal papillary-mucinous neoplasm ... 2.000 1.5e-03
invasive ductal carcinoma 1.700 1.7e-03
lung adenocarcinoma 1.109 1.1e-03
lung cancer 2.800 1.4e-05
malignant mesothelioma 2.700 7.1e-09
medulloblastoma, large-cell 3.500 3.8e-07
nasopharyngeal carcinoma 1.400 2.0e-06
non-small cell lung cancer 2.976 2.2e-32
oligodendroglioma 1.100 6.9e-07
ovarian cancer 1.700 7.4e-05
pituitary cancer 1.100 5.0e-06
primitive neuroectodermal tumor 2.700 3.4e-05
psoriasis 2.000 1.6e-04

Gene RIF (93)

AA Sequence

MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGE      1 - 70
ELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDREAGRGLGRMRRGLLYDSD     71 - 140
EEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSH    141 - 210
GHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNH    211 - 280
IHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPG    281 - 350
SCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN    351 - 420
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHED    421 - 490
IKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYV    491 - 560
QRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAA    561 - 630
NPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGS    631 - 700
AAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESM    701 - 770
IRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV    771 - 840
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF          841 - 904
//

Text Mined References (165)

PMID Year Title