Property Summary

NCBI Gene PubMed Count 44
PubMed Score 49.93
PubTator Score 35.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 1.600 3.2e-07
psoriasis 2.000 1.7e-125
osteosarcoma -1.480 1.3e-02
posterior fossa group A ependymoma 1.500 6.9e-05
glioblastoma 2.900 2.5e-06
group 3 medulloblastoma 3.700 6.0e-08
atypical teratoid / rhabdoid tumor 3.000 7.3e-12
medulloblastoma, large-cell 4.000 2.4e-08
primitive neuroectodermal tumor 3.200 3.0e-05
Atopic dermatitis 1.400 1.0e-03
adrenocortical carcinoma 1.354 9.6e-03
non-small cell lung cancer 2.567 2.8e-23
intraductal papillary-mucinous carcinoma... 1.200 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.6e-03
lung cancer 3.300 3.0e-06
lung adenocarcinoma 1.100 1.8e-12
pediatric high grade glioma 2.700 1.0e-07
nasopharyngeal carcinoma 1.200 5.9e-04
Breast cancer 2.200 1.2e-08
breast carcinoma 1.200 4.9e-20
ductal carcinoma in situ 1.100 3.3e-02
invasive ductal carcinoma 2.900 1.9e-03
ulcerative colitis 1.200 3.3e-05
ovarian cancer 1.900 1.3e-05

Protein-protein Interaction (6)

Gene RIF (26)

PMID Text
26401039 HIV-1 depletes MCM10 in a Vpr-dependent manner
26032416 MCM10 is the natural substrate of the Cul4-DDB1[VprBP] E3 ubiquitin ligase whose degradation is regulated by VprBP, but Vpr enhances the proteasomal degradation of MCM10 by interacting with VprBP.
26032416 HIV-1 depletes MCM10 in a Vpr-dependent manner
25602958 RecQL4-dependent association of Mcm10 and Ctf4 with replication origins appears to be the first important step controlled by S phase promoting kinases and checkpoint pathways for the initiation of DNA replication in human cells.
24662891 Loss of Mcm10 engages checkpoint, DNA repair and SUMO-dependent rescue pathways that collectively counteract replication stress and chromosome breakage. [Review]
23750504 Data suggest that CDC45 and MCM10 (minichromosome maintenance complex component 10) directly interact and establish a mutual co-operation in DNA binding; key domains appear to interact and then interact with DNA inside cells or in cell-free systems.
23449222 This report shows that human Mcm10 is an acetylated protein regulated by SIRT1, which binds and deacetylates Mcm10 both in vivo and in vitro, and modulates Mcm10 stability and ability to bind DNA.
22918587 Mcm10 utilizes a modular architecture to act as a replisome scaffold, which helps to define possible roles in origin DNA melting, Pol alpha recruitment and coordination of enzymatic activities during elongation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20064936 High doses of ionizing gamma radiation and exposure to a combination of DNA-damaging chemicals do not decrease Mcm10 protein levels, demonstrating that Mcm10 down-regulation is triggered only by UV-specific damage
19805216 Assembly of the Cdc45-Mcm2-7-GINS complex requires the Ctf4/And-1, RecQL4, and Mcm10 proteins.
19795399 Observational study of gene-disease association. (HuGE Navigator)
19696745 MCM10 interacts directly with RECQ4 and regulates its DNA unwinding activity.
19608746 DNA and p180 binding to an Mcm10 construct that contains both the ID and CTD, provide the first mechanistic insight into how Mcm10 might use a handoff mechanism to load and stabilize pol alpha within the replication fork.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17997981 These results indicate that MCM10 protein is essential for maintaining genome integrity as well as cell cycle progression.
17997977 MCM10 is essential for the efficient elongation step of chromosome replication.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17823614 Results show that MCM10 molecule is a ring-shaped hexamer with large central and smaller lateral channels and a system of inner chambers.
17761813 Mcm10 is required for chromatin loading of And-1.
17699597 These results argue that cells can tolerate low levels of p180 as long as Mcm10 is present to "recycle" it.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15195143 transcription of human MCM10 and TopBP1 is activated by transcription factors E2F1-3, but not by factors E2F4-7
15136575 human Mcm10 is temporarily recruited to the replication sites 30-60 min before they replicate and dissociates from chromatin after the activation of the prereplication complex
12808023 Functional studies of the Drosophila homolog
11864598 Functional studies of the Xenopus homolog

AA Sequence

MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEADDGETGETRDE      1 - 70
KENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELRNLQEQMKALQEQLKVTTIKQ     71 - 140
TASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDVPALPRTKRVARTPKASPPDPKSSSSRMTSA    141 - 210
PSQPLQTISRNKPSGITRGQIVGTPGSSGETTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQI    211 - 280
KEKMAREKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTV    281 - 350
VGILNANPMKPKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQY    351 - 420
KKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPKKKIQTTLSNL    421 - 490
VVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASA    491 - 560
LLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSSRQPPAQPPRTGSEFPRLEGAPATMTPKLGR    561 - 630
GVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEK    631 - 700
NTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKM    701 - 770
RNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYK    771 - 840
WERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK                                       841 - 875
//

Text Mined References (48)

PMID Year Title
26032416 2015 HIV-1 Vpr Protein Enhances Proteasomal Degradation of MCM10 DNA Replication Factor through the Cul4-DDB1[VprBP] E3 Ubiquitin Ligase to Induce G2/M Cell Cycle Arrest.
25602958 2015 RecQL4 is required for the association of Mcm10 and Ctf4 with replication origins in human cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24726359 2014 The RBBP6/ZBTB38/MCM10 axis regulates DNA replication and common fragile site stability.
24662891 2014 MCM10: one tool for all-Integrity, maintenance and damage control.
23750504 2013 The physical interaction of Mcm10 with Cdc45 modulates their DNA-binding properties.
23449222 2013 Human SIRT1 regulates DNA binding and stability of the Mcm10 DNA replication factor via deacetylation.
22918587 2012 Structural biology of replication initiation factor Mcm10.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20064936 2010 Ultraviolet radiation stress triggers the down-regulation of essential replication factor Mcm10.
19805216 2009 Assembly of the Cdc45-Mcm2-7-GINS complex in human cells requires the Ctf4/And-1, RecQL4, and Mcm10 proteins.
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
19696745 2009 MCM10 mediates RECQ4 association with MCM2-7 helicase complex during DNA replication.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608746 2009 Physical interactions between Mcm10, DNA, and DNA polymerase alpha.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17997981 2008 Knockdown of human MCM10 activates G2 checkpoint pathway.
17997977 2008 Knockdown of human MCM10 exhibits delayed and incomplete chromosome replication.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17823614 2007 Hexameric ring structure of human MCM10 DNA replication factor.
17761813 2007 Mcm10 and And-1/CTF4 recruit DNA polymerase alpha to chromatin for initiation of DNA replication.
17699597 2007 Human Mcm10 regulates the catalytic subunit of DNA polymerase-alpha and prevents DNA damage during replication.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232106 2004 Self-assembling protein microarrays.
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
15195143 2004 Expression of MCM10 and TopBP1 is regulated by cell proliferation and UV irradiation via the E2F transcription factor.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15136575 2004 Localization of human Mcm10 is spatially and temporally regulated during the S phase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12844493 2003 A novel zinc finger is required for Mcm10 homocomplex assembly.
12808023 2003 Drosophila MCM10 interacts with members of the prereplication complex and is required for proper chromosome condensation.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045100 2002 DNA replication in eukaryotic cells.
11889827 2002 [Abnormal myocardial contractile regulation mechanism in familial hypertrophic and dilated cardiomyopathies--functional analysis of molecular mutant troponin in in-vitro].
11864598 2002 Xenopus Mcm10 binds to origins of DNA replication after Mcm2-7 and stimulates origin binding of Cdc45.
11602595 2001 Cell cycle-dependent proteolysis and phosphorylation of human Mcm10.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11095689 2000 The human homolog of Saccharomyces cerevisiae Mcm10 interacts with replication factors and dissociates from nuclease-resistant nuclear structures in G(2) phase.