Property Summary

Ligand Count 13
NCBI Gene PubMed Count 26
PubMed Score 81.84
PubTator Score 55.80

Knowledge Summary

Patent (14,023)

TINX Plot

  Disease (5)

Disease Target Count
Bipolar Disorder 666
Schizophrenia 1160
Disease Target Count P-value
group 3 medulloblastoma 4104 7.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 2.0

Gene RIF (12)

AA Sequence

MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTIIRSRKKTVPDI      1 - 70
YICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFACSAIMTVMSVDRYFALVQPFR     71 - 140
LTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDGVESCAFDLTSPDDVLWYTLYLTITTFFFPL    141 - 210
PLILVCYILILCYTWEMYQQNKDARCCNPSVPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQP    211 - 280
TLAFYVGYYLSICLSYASSSINPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF              281 - 340
//

Text Mined References (26)

PMID Year Title