Property Summary

NCBI Gene PubMed Count 26
PubMed Score 82.46
PubTator Score 55.80

Knowledge Summary

Patent (14,023)

TINX Plot

  Disease (3)

Gene RIF (12)

PMID Text
26461262 This study provides new insights on the possible influence of MCHR2 and/or MCHR2-AS1 on obesity in psychiatric patients and on the pathophysiology of atypical depression.
22123324 Discovery and characterization of a potent and selective antagonist of melanin-concentrating hormone receptor 2
20099459 construction of the CHO cell line and the research of MCHR2 molecular characteristics have established a good experimental basis for the further research about the function of MCHR2 gene
19927306 Observational study of gene-disease association. (HuGE Navigator)
19683862 MCHR2 positively mediates the regulation of melanin-concentrating hormone during preadipocyte differentiation and is involved in energy balance regulation without affecting preadipocyte proliferation.
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17698913 Observational study of gene-disease association. (HuGE Navigator)
17698913 MCHR2 is not a major contributor to polygenic obesity
15941924 Observational study of gene-disease association. (HuGE Navigator)
15229878 results of molecular simulations of MCHR2 in the free and hormone-bound forms provide suggestions on the amino acids responsible for the transfer of the structural changes from the agonist binding site to the G-protein coupling domains
12127971 MCH1 and MCH2 receptors were investigated and are different from those in SVK14 cells.
11478907 The 10-amino-acid cyclic core of the hMCH neuropeptide with the Arg attached to the N-terminus of the disulfide ring is sufficient for full activation of melanin-concentrating hormone receptor 2.

AA Sequence

MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTIIRSRKKTVPDI      1 - 70
YICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFACSAIMTVMSVDRYFALVQPFR     71 - 140
LTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDGVESCAFDLTSPDDVLWYTLYLTITTFFFPL    141 - 210
PLILVCYILILCYTWEMYQQNKDARCCNPSVPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQP    211 - 280
TLAFYVGYYLSICLSYASSSINPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF              281 - 340
//

Text Mined References (26)

PMID Year Title
26461262 2015 Influence of MCHR2 and MCHR2-AS1 Genetic Polymorphisms on Body Mass Index in Psychiatric Patients and In Population-Based Subjects with Present or Past Atypical Depression.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
22123324 2012 Discovery and characterization of a potent and selective antagonist of melanin-concentrating hormone receptor 2.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20099459 2009 Establishment of CHO cell line expressing human MCHR2 gene and research of its molecular characteristics.
19927306 2010 A systematic association mapping on chromosome 6q in bipolar affective disorder--evidence for the melanin-concentrating-hormone-receptor-2 gene as a risk factor for bipolar affective disorder.
19683862 2009 Melanin-concentrating hormone receptor 2 affects 3T3-L1 preadipocyte differentiation.
19502010 2009 Two complex genotypes relevant to the kynurenine pathway and melanotropin function show association with schizophrenia and bipolar disorder.
17698913 2007 Genetic study of the melanin-concentrating hormone receptor 2 in childhood and adulthood severe obesity.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
15941924 2005 Mutation analysis of the MCHR1 gene in human obesity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340116 2004 Identification and characterization of single-nucleotide polymorphisms in MCH-R1 and MCH-R2.
15229878 2004 Structural features of the inactive and active states of the melanin-concentrating hormone receptors: insights from molecular simulations.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12620396 2003 The structure and evolution of the melanocortin and MCH receptors in fish and mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127971 2002 SVK14 cells express an MCH binding site different from the MCH1 or MCH2 receptor.
11839762 2002 Synthesis and biological evaluation in vitro of a selective, high potency peptide agonist of human melanin-concentrating hormone action at human melanin-concentrating hormone receptor 1.
11478907 2001 Short segment of human melanin-concentrating hormone that is sufficient for full activation of human melanin-concentrating hormone receptors 1 and 2.
11459838 2001 Identification and pharmacological characterization of a novel human melanin-concentrating hormone receptor, mch-r2.
11416225 2001 Identification and characterization of a melanin-concentrating hormone receptor.
11404457 2001 Identification and characterization of a second melanin-concentrating hormone receptor, MCH-2R.
11355873 2001 Cloning of a novel G protein-coupled receptor, SLT, a subtype of the melanin-concentrating hormone receptor.
11274220 2001 Molecular cloning and functional characterization of MCH2, a novel human MCH receptor.