Property Summary

NCBI Gene PubMed Count 32
PubMed Score 33.44
PubTator Score 30.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

 GO Function (1)

Protein-protein Interaction (1)

PDB (10)

Gene RIF (21)

AA Sequence

MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQ      1 - 70
ELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAE     71 - 140
FAKSLQ                                                                    141 - 146
//

Text Mined References (37)

PMID Year Title