Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.13
PubTator Score 5.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.557 2.3e-04
tuberculosis and treatment for 6 months -1.600 4.5e-04
non-small cell lung cancer -4.431 2.4e-32
pancreatic cancer 1.100 3.4e-03
lung adenocarcinoma -3.000 1.7e-16
lung carcinoma -1.900 4.7e-16
ulcerative colitis 1.400 7.8e-03
psoriasis 1.400 4.2e-08

Gene RIF (2)

PMID Text
26846866 The expression of the gene MCEMP1 had the strongest association with stroke of 11,181 genes tested.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of chromosome 19 open reading frame 59 (C19orf59; MCEMP1) in peptide-treated PBMCs

AA Sequence

MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPS      1 - 70
DSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGW     71 - 140
DSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ                           141 - 187
//

Text Mined References (5)

PMID Year Title
26846866 2016 Peripheral Blood MCEMP1 Gene Expression as a Biomarker for Stroke Prognosis.
15953541 2005 Identification and expression of a new type II transmembrane protein in human mast cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.