Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.70
PubTator Score 13.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Methylmalonyl-CoA Epimerase Deficiency 1 0.0 0.0
Disease Target Count Z-score Confidence
Methylmalonic acidemia 37 5.396 2.7

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.016 3.8e-03
ovarian cancer -1.100 5.6e-05
pancreatic ductal adenocarcinoma liver m... -2.589 6.1e-04
Pick disease -1.100 1.0e-04

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILG      1 - 70
AQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKK     71 - 140
KIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA                                      141 - 176
//

Text Mined References (13)

PMID Year Title