Property Summary

NCBI Gene PubMed Count 39
PubMed Score 19.58
PubTator Score 45.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.400 1.6e-02
Breast cancer -1.600 6.9e-05
cystic fibrosis 2.824 3.7e-05
glioblastoma 1.100 6.0e-04
group 3 medulloblastoma 1.700 1.3e-03
interstitial cystitis -1.100 1.5e-03
intraductal papillary-mucinous adenoma (... -1.700 2.4e-02
intraductal papillary-mucinous carcinoma... -2.900 1.5e-03
invasive ductal carcinoma -1.229 1.9e-03
lung cancer -1.700 1.1e-02
malignant mesothelioma -4.300 3.7e-08
medulloblastoma, large-cell 2.100 8.6e-05
osteosarcoma 3.288 2.0e-07
ovarian cancer -4.400 2.2e-11
pancreatic ductal adenocarcinoma liver m... -2.698 6.0e-04
ulcerative colitis 1.900 1.7e-04

 GO Function (1)

Gene RIF (13)

AA Sequence

MNSGVAMKYGNDSSAELSELHSAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQCEQSHLMREHEDV      1 - 70
QERTTLRYEERITELHSVIAELNKKIDRLQGTTIREEDEYSELRSELSQSQHEVNEDSRSMDQDQTSVSI     71 - 140
PENQSTMVTADMDNCSDLNSELQRVLTGLENVVCGRKKSSCSLSVAEVDKHIEQLTTASEHCDLAIKTVE    141 - 210
EIEGVLGRDLYPNLAEERSRWEKELAGLREENESLTAMLCSKEEELNRTKATMNAIREERDRLRRRVREL    211 - 280
QTRLQSVQATGPSSPGRLTSTNRPINPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDRPVLGSE    281 - 350
ISSIGVSSSVAEHLAHSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERLNSRIEHLKSQNDLLTIT    351 - 420
LEECKSNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESEQSLILGQFRAAGVGSSPGDQS    421 - 490
GDENITQMLKRAHDCRKTAENAAKALLMKLDGSCGGAFAVAGCSVQPWESLSSNSHTSTTSSTASSCDTE    491 - 560
FTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSYDVKPRGDSQRLDLENAVLMQELMAMKEEMA    561 - 630
ELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIEHLKSEVEEQKEQRMRSLSSTSSGSKDKPGKECADA    631 - 700
ASPALSLAELRTTCSENELAAEFTNAIRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANS    701 - 770
NLVAAYEKAKKKHQNKLKKLESQMMAMVERHETQVRMLKQRIALLEEENSRPHTNETSL               771 - 829
//

Text Mined References (43)

PMID Year Title