Property Summary

NCBI Gene PubMed Count 12
PubMed Score 82.44
PubTator Score 194.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.3e-05
psoriasis 6685 1.0e-04
non-inflammatory breast cancer 208 2.7e-03
Multiple Sclerosis 498 3.1e-03
Disease Target Count Z-score Confidence
Otitis media 32 3.81 1.9
Leptospirosis 17 3.407 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.600 1.0e-04
Multiple Sclerosis -1.400 3.1e-03
non-inflammatory breast cancer -2.700 2.7e-03
ovarian cancer 1.400 1.3e-05

Protein-protein Interaction (4)

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQ      1 - 70
GSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQP     71 - 140
SVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLE    141 - 210
AREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEP    211 - 280
LTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGP    281 - 350
GRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR                                  351 - 390
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16434556 2006 Exercise training decreases the concentration of malonyl-CoA and increases the expression and activity of malonyl-CoA decarboxylase in human muscle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12882974 2003 Cloning, expression, characterization, and interaction of two components of a human mitochondrial fatty acid synthase. Malonyltransferase and acyl carrier protein.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.