Property Summary

NCBI Gene PubMed Count 133
PubMed Score 555.86
PubTator Score 408.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
urothelial carcinoma 2.500 9.7e-06
psoriasis -1.100 3.6e-03
osteosarcoma 1.886 4.8e-02
cystic fibrosis 2.200 6.4e-04
glioblastoma 1.700 9.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.382 7.3e-04
juvenile dermatomyositis 1.739 3.3e-12
acute quadriplegic myopathy 1.481 1.4e-05
tuberculosis -1.200 2.6e-05
intraductal papillary-mucinous adenoma (... -2.300 1.4e-04
intraductal papillary-mucinous carcinoma... -2.000 5.7e-04
intraductal papillary-mucinous neoplasm ... -2.300 3.6e-03
breast carcinoma -1.900 5.4e-04
fibroadenoma -1.900 2.5e-02
diabetes mellitus -1.100 3.6e-02
interstitial cystitis 1.300 3.3e-03
pediatric high grade glioma 1.200 2.2e-03
group 4 medulloblastoma -1.300 3.3e-03
pilocytic astrocytoma 1.100 2.5e-03
non primary Sjogren syndrome sicca 1.100 2.5e-02
lung adenocarcinoma -1.092 1.4e-05
Breast cancer -1.400 1.9e-07
gastric carcinoma 2.000 5.2e-03
ductal carcinoma in situ -2.300 4.5e-04
invasive ductal carcinoma -2.900 6.9e-04
ulcerative colitis 2.100 1.0e-05
ovarian cancer 2.200 8.4e-05
pancreatic cancer 1.100 2.5e-03
dermatomyositis 1.700 2.9e-03

Pathway (1)

Protein-protein Interaction (4)

Gene RIF (105)

PMID Text
26941359 CD146 is a novel and useful marker for predicting senescence in human umbilical cord blood-derived Mesenchymal stem cells (hUCB-MSCs), and CD146 can potentially be applied in quality-control assessments of hUCB-MSC-based therapy.
26928402 Results showed that CD146 promoted metastasis of hepatocellular carcinoma (HCC) cells and predicted poor prognosis of HCC patients. CD146 induced epithelial mesenchymal transition through probably IL-8 up-regulation and STAT1 down-regulation.
26906545 Results showed that increased human METCAM/MUC18 expression in ovarian cancer SK-OV-3 cells suppressed tumorigenesis and ascites formation in nude mice, suggesting that human METCAM/MUC18 plays a suppressor role in the progression of ovarian cancer, perhaps by reducing proliferation and angiogenesis.
26753846 CD146 dexpression efines a subpopulation of human mesenchymal stem cells capable of bone formation and in vivo trans-endothelial migration.
26617818 MUC18 is an independent prognostic factor for clear cell renal cell carcinoma
26517673 Data indicate that CD146 antigen is an effective cell surface marker for enriching tumor-propagating cells (TPCs) in primary sarcomas.
26293576 CD146, P53, and Ki-67 are overexpressed in uterine sarcoma
26004137 a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1
25997612 The expression of CD146 and HIF1a was positively correlated with EGFR and CD31, respectively in salivary gland adenoid cystic carcinoma.
25995384 ZBTB7A directly binds to the promoter and transcriptionally represses the expression of MCAM, establishing ZBTB7A as a bona fide transcriptional repressor of MCAM
25869475 MCAM is expressed by effector CD8+ T lymphocytes and it is strikingly upregulated during multiple sclerosis relapses. MCAM blockade restricts the transmigration of CD8(+) T lymphocytes across human blood-brain barrier endothelial cells.
25756799 MCAM is a major GAL-1 ligand is largely dependent on melanoma malignancy.
25729916 In peripheral stenotic arteriosclerotic disease the proangiogenic potency of MUC18 may play a role in angiogenesis of collaterals, whereas in dilatative aortic diseases the induction of collaterals is typically not evident.
25728681 Results identified MCAM as a novel YAP target in hepatocellular carcinoma (HCC) but not in breast and colon cancer cells. MCAM serum levels were specifically elevated in HCC suggesting it as a specific diagnostic tool for HCC.
25552367 Combined EpCAM/MCAM CellSearch enrichment thus increased the CTC detection rate.
25510693 HuMETCAM/MUC18 levels in ovarian carcinomas and metastatic lesions were significantly higher than in normal tissues and cystadenomas.
25275584 These data suggest CDCP1 expression can be used to identify a subset of marrow fibroblasts functionally distinct from CD146+ fibroblasts.
25266708 With the ability of migration and survival in the advanced osteoarthritis cartilage, CD146+ chondroprogenitors might be "tissue-specific" for cartilage tissue regeneration.
25238265 Suggest endothelial CD146 as a target for specific drug delivery in hepatocellular carcinoma.
25135296 lymphocyte trafficking into the CNS under VLA-4 blockade can occur by using the alternative adhesion molecules, PSGL-1 and MCAM, the latter representing an exclusive pathway for TH17 cells to migrate over the blood-brain barrier
24902661 expression behaves as a molecular warning of melanoma progression
24743054 Authors conclude therefore that ETs upregulate MCAM in an Akt and ERK/MEK-dependent, but CREB-independent manner, providing an understanding for possible pharmacologic intervention in progressing melanoma.
24727891 Data proposed a novel signaling mechanism by which Sema 3A regulates PTEN, FOXO 3a and MelCAM in a coordinated manner that leads to suppression of breast cancer growth and angiogenesis.
24726881 functional characterization of N-acetylglucosaminyltransferases III and V in human melanoma cells
24681327 These results indicate that mAbs to the laminin a4 globular domain are able to inhibit tumor cell adhesion and migration on laminins 411 and 421, and that alpha6beta1 integrin and MCAM bind a4-laminins at very close sites on the globular domain
24612514 CD146 and its soluble form correlate with the development of inflammation of atherosclerosis and plaque instability; CD146 may be a promising biomarker for monitoring the development and instability of atherosclerotic plaque in carotid disease patients
24473396 The CEC count and the plasma level of sCD146 were significantly higher in NSCLC patients.
24335906 Wingless-type protein Wnt5a uses CD146 as a receptor to regulate cell migration.
24204598 CD146+ human umbilical cord perivascular cells maintain stemness under hypoxia and as a cell source for skeletal regeneration.
24188055 A strong expression of CD146 molecule is associated with a commitment to a vascular smooth muscle cell lineage in mesenchymal stem cells.
24139427 Mean sCD146 levels were significantly higher in type 1 diabetes patients than in controls. ROC curves for sCD146 significantly differed in differentiating type 1 diabetics from healthy controls.
23878390 Identified a novel negative regulator of angiogenesis, microRNA 329 (miR-329), that directly targeted CD146 and inhibited CD146-mediated angiogenesis in vitro and in vivo.
23749325 MCAM expression in surgically treated non-small cell lung cancer is clearly associated with lymph node metastasis and poor prognosis.
23738744 CD146 expression is characterized in circulating T cells from healthy controls and patients with stable, well-controlled connective tissue diseases; both CD4 and CD8 T cells are capable of up-regulating CD146 expression in response to stimulation.
23712706 CD146 and Lxn increased tumor migration and invasion of thyroid cancer.
23670160 miR-573 upregulation inhibited melanoma cell proliferation and invasion, and overexpression of melanoma cell adhesion molecule (MCAM) could alleviate the effect of miR-573 on melanoma cells.
23649916 Alterations in CD146 are involved in the basic etiology of COPD/pulmonary emphysema.
23412095 Data show that CD146+ perivascular cells are a subset of mesenchymal stem/stromal cells (MSCs), able to support hematopoietic stem and progenitor cells (HSPCs) and regulate lineage commitment in vitro through cell-to-cell interaction.
23389031 Soluble melanoma cell adhesion molecule (sMCAM/sCD146) promotes angiogenic effects on endothelial progenitor cells through angiomotin
23333866 cerebrospinal fluid levels of sCD146 may provide a potential marker for monitoring disease activity in multiple sclerosis patients
23266426 REVIEW: newly identified functions and the underlying mechanisms of CD146
23256918 MUC18 exerts a proinflammatory function during lung bacterial infection.
23223580 CD146 and its novel ligand Galectin-1 have a role in apoptotic regulation of endothelial cells
23108590 propose that in human, sCD146 could represent both an attractive biomarker of placental vascular development and a therapeutic target in pregnancy complications associated with pathological angiogenesis
22975388 MCAM serves as a potential biomarker for multiple sclerosis and represents a valuable target for the treatment of neuroinflammatory conditions.
22952755 CD146 expression is associated with an EMT phenotype
22826148 CD146 gene expression can be useful for predicting early recurrence and stratifying the patients into risk groups for possible adjuvant treatment
22801967 Data indicate that the expression of the melanoma cell adhesion molecule (MCAM) in mesenchymal stromal cells determines their fate and regulates the maintenance of hematopoietic stem and progenitor cells through direct cell-cell contact.
22754372 Results show that that CD146 is expressed in 41% of gastric neoplasm cells and correlated positively with lymph node metastasis and epithelial-mesenchymal transition markers making it a good prognostic factor.
22718841 Data suggest that CD146 interacts with VEGFR-2 in vascular endothelium and promotes angiogenesis; studies include identifying the basis of CD146 binding to VEGFR-2.
22635231 sCD146 levels are significantly higher in women presenting a history of recurrent fetal losses.
22610942 MCAM expression in ovarian cancer is highly correlated with the metastatic potential of the cancer.
22399604 positive expression of CD146 was associated with a poorer OS according to the survival analysis. CD146 may be a useful marker for predicting poor prognosis in patients with NSCLC following complete resection
22311021 The preferential interaction between soluble CD146 and CD16 positive monocytes may contribute to activation and homing of monocytes into inflamed vascular beds.
22088599 Expression of CD146 and P-selectin in patients with type 2 diabetes is elevated, and they are positively correlated with severity of diabetic nephropathy.
22076922 this study suggested that the elevated expression of CD146, angiogenesis, and lymphangiogenesis might be closely related to progression, invasion, metastasis, and prognosis of gallbladder adenocarcinoma.
22057013 METCAM/MUC18 expression increased in vitro motility, invasiveness, and anchorage-independent colony formation of SK-BR-3 cells and favored disorganized growth of the cells in 3D basement membrane culture
22051146 CD146 expression in vascular endothelial cells was significantly higher than that in invasive ductal carcinoma (IDC), and was positively correlated with tumor progression in invasive micropapillary carcinoma and IDC, not otherwise specified.
21959269 elevated expression on CD4(+) T cells in autoimmune diseases
21804459 Data show that expression of IPO13, c-kit, telomerase, caspase3, and CD146 are decreased in endometrial polyps; however, the expression of bcl-2 was increased in polyps compared to the normal endometrial tissue.
21725352 It was shown that CD146 physically interacts with actin-linking ezrin-radixin-moesin proteins and recruits them to cell protrusions, promoting the formation and elongation of microvilli.
21467165 MUC18 is involved in cell signaling regulating the expression of Id-1 and ATF-3, thus contributing to melanoma metastasis
21450088 promotes motility, invasion, and tumorigenesis of human breast cancer cells
21415267 novel findings show that the expression of CD146 differentiates between perivascular versus endosteal localization of non-hematopoietic bone marrow mesenchymal stem cell populations
21334670 Enforced expression of human metastasis cell adhesion molecule/MUC18 increases prostate tumorigenesis in vivo and may affect the process by increasing proliferation
21239604 an allergic airway milieu (e.g., IL-13) increases MUC18 expression, which may contribute to increased bacterial infection/colonization in asthma and other lung diseases
21095067 CD146 may be a key gene both in neoplasm invasion and blastocyst embedding because of its ability in regulating cell invasion.
20657552 Propose that CD146 is a sensitive and specific immunocytochemical marker enabling differential diagnosis of malignant pleural mesothelioma from reactive mesothelium.
20589320 mRNA levels of CD31, CD144, CD146 and vWf in whole blood as detected by real time RT-PCR cannot be used as biomarkers for end-stage endothelial cells such as circulating endothelial cells.
20448216 CD146 short isoform overexpression displays a distinct function in blood vessel regeneration.
20127798 CD146 may serve as a marker of multipotency in human mesenchymal stem cells, with higher expression in tripotent vs. unipotent clonal populations.
20067117 CD146 was mainly expressed in renal tubular epithelial cells, and might play an important role in the progression of IgA nephropathy.
19782948 This study for the first time uncovered the pro-angiogenic role of CD146 and also pinpointed the key structural basis responsible for its signaling function and dimerization.
19703903 analysis of the cross-talk between protease-activated receptor 1 and platelet-activating factor receptor regulates melanoma cell adhesion molecule (MCAM/MUC18) expression and melanoma metastasis
19229070 CD146 is regulated by the inflammatory cytokine Tumor necrosis factor alpha and that CD146 and solubleCD146 are both involved in monocyte transendothelial migration during inflammation.
19221091 Identification of MCAM/CD146 as the surface antigen bound by one of the mesothelioma-targeting human single chain antibodies in cultured tumor cells.
19200179 may play an important role in the carcinogenesis, progression and perineural invasion activity of adenoid cystic carcinoma
19123925 CD146 downmodulation is associated with the reversal of several biological characteristics associated with epithelial to mesenchymal transition, and the phenomenon associated with the metastatic process in human breast tumors.
19034879 CD146 might be a novel marker for RTECs, correlating with cell proliferation and cell-cell conjunctions. High glucose up-regulates both CD146 and sCD146 expression.
19029148 CD146(+) cell involvement in bone marrow stromal changes occurring in primary myelofibrosis are consistent with the capability of these cells to participate in fiber deposition, angiogenesis, and bone formation
18922915 A subset of host B lymphocytes controls melanoma metastasis through a melanoma cell adhesion molecule/MUC18-dependent interaction.
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
18604730 The immunoreactivity of the polyclonal CD146 antibody (Abcam, ab28360) is prognostic of PSA-relapse in prostate cancer patients
18175063 A decrease in serum adiponectin levels and an increase in serum CD146 may be closely associated with the development of arteriosclerosis obliterans, regardless of renal function.
18160586 Elevated adiponectin correlated to CD146 may be the expression of a counterregulatory response aimed at mitigating the consequences in endothelial damage and increased cardiovascular risk in renal failure.
17982057 MCAM might be involved in the recruitment of activated T cells to inflammation sites.
17872908 CD146 and platelet-derived growth factor-receptor beta are expressed in colony-forming endometrial stromal cells which may be mesenchymal stem cells, and have roles in the cells' cyclical growth
17786470 Vasculature in tumours and in retina and choroid of all melanoma-affected and normal eyes showed intense MUC18 immunostaining. observations further suggest a role for MUC18 in uveal melanoma growth.
17545460 CD146(an endothelial cell marker)is also expressed on lymphocytes,implicating its role in T cell adherence and activation to vascular endothelium
17490776 Plasma levels may be involed in the development of vascular complication in end stage of diabetic nephropathy.
17320204 These data provide the first evidence that CD146 dimerization occurs in living cells and is regulated within the tumor microenvironment, implying that dimerization of CD146 may be associated with malignancy.
16969099 MCAM expression doees not correlates with progression to advanced-stage melanoma.
16835268 Results identify melanoma cell adhesion molecule as a novel marker for myogenic progenitors in human fetal muscle and confirm that downregulation of this protein promotes myoblast fusion.
16804906 M-CAM is a marker of early relapse and poorer outcome in epithelial ovarian cancer
16570276 Our data indicate a correlation between MUC18 expression and the invasiveness of uveal melanoma cells.
16541130 results demonstrate that CD146 plays a key role in vascular endothelial cell activity and angiogenesis
16204154 CD146 is a new marker of activated lymphocytes, not just an adhesion marker of endothelial cells
16098047 When cell surface glycoprotein gp130 was purified and analyzed by peptide mass fingerprinting, we could demonstrate that it is MUC18 (Mel-CAM, CD146)
15897668 Elevation of adiponectin may be a defense mechanism against endothelial damage, reflected by elevated CD146 and thrombomodulin.
15610525 endothelin-1 (ET-1) upregulates MCAM protein in primary human melanocytes
14597988 sCD146 circulates in the plasma of healthy subjects; significantly increased levels of sCD146 in blood and CD146 in kidney endothelial cells of patients with chronic renal failure were observed.
14534536 MCAM and akt protein are reciprocally regulated.
12406332 The 28mer peptides are structural equivalents of the MAd18-5D7 epitope of Mel-CAM.
11848444 Acute hyperglycaemia induces an up-regulation of seven major genes, four of which were not previously reported in the literature. Northern blot analyses, performed on these 4 genes, confirm macroarrays results for alphav, beta4, c-myc, and MUC18.
11722842 Increased expression of MUC18 is implicated to play an important role in developing and malignant progression of human prostate cancer.

AA Sequence

MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKR      1 - 70
TLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPN     71 - 140
IQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKA    141 - 210
QLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPP    211 - 280
HFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSP    281 - 350
AAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT    351 - 420
QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTP    421 - 490
ELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGV    491 - 560
VIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGD    561 - 630
KRAPGDQGEKYIDLRH                                                          631 - 646
//

Text Mined References (137)

PMID Year Title
26941359 2016 Downregulation of Melanoma Cell Adhesion Molecule (MCAM/CD146) Accelerates Cellular Senescence in Human Umbilical Cord Blood-Derived Mesenchymal Stem Cells.
26928402 2016 CD146 promotes metastasis and predicts poor prognosis of hepatocellular carcinoma.
26906545 2016 METCAM/MUC18 is a novel tumor and metastasis suppressor for the human ovarian cancer SKOV3 cells.
26753846 2016 CD146/MCAM defines functionality of human bone marrow stromal stem cell populations.
26617818 2015 Decreased expression of mucin 18 is associated with unfavorable postoperative prognosis in patients with clear cell renal cell carcinoma.
26517673 2015 Identification of CD146 as a marker enriched for tumor-propagating capacity reveals targetable pathways in primary human sarcoma.
26293576 2015 CD146 as an adverse prognostic factor in uterine sarcoma.
26004137 2015 CD166 positively regulates MCAM via inhibition to ubiquitin E3 ligases Smurf1 and ?TrCP through PI3K/AKT and c-Raf/MEK/ERK signaling in Bel-7402 hepatocellular carcinoma cells.
25997612 2015 Role of hypoxia-inducible factor-1? and CD146 in epidermal growth factor receptor-mediated angiogenesis in salivary gland adenoid cystic carcinoma.
25995384 2015 ZBTB7A Suppresses Melanoma Metastasis by Transcriptionally Repressing MCAM.
25869475 2015 Melanoma cell adhesion molecule-positive CD8 T lymphocytes mediate central nervous system inflammation.
25756799 2015 Melanoma Cell Galectin-1 Ligands Functionally Correlate with Malignant Potential.
25729916 2015 Proangiogenic potency of MUC18 in arteriosclerotic disease.
25728681 2015 The membrane protein melanoma cell adhesion molecule (MCAM) is a novel tumor marker that stimulates tumorigenesis in hepatocellular carcinoma.
25552367 2015 Improved Circulating Tumor Cell Detection by a Combined EpCAM and MCAM CellSearch Enrichment Approach in Patients with Breast Cancer Undergoing Neoadjuvant Chemotherapy.
25510693 2014 Frequent and increased expression of human METCAM/MUC18 in cancer tissues and metastatic lesions is associated with the clinical progression of human ovarian carcinoma.
25275584 2014 CDCP1 identifies a CD146 negative subset of marrow fibroblasts involved with cytokine production.
25266708 2015 CD146 as a new marker for an increased chondroprogenitor cell sub-population in the later stages of osteoarthritis.
25238265 2014 Selective targeting of liver cancer with the endothelial marker CD146.
25135296 2014 VLA-4 blockade promotes differential routes into human CNS involving PSGL-1 rolling of T cells and MCAM-adhesion of TH17 cells.
24902661 2014 Sequential molecular analysis of circulating MCAM/MUC18 expression: a promising disease biomarker related to clinical outcome in melanoma.
24743054 2014 Akt and PI3K-dependent but CREB-independent upregulation of MCAM by endothelin-3 in human melanocytes.
24727891 2015 Semaphorin 3A upregulates FOXO 3a-dependent MelCAM expression leading to attenuation of breast tumor growth and angiogenesis.
24726881 2014 Overexpression of N-acetylglucosaminyltransferases III and V in human melanoma cells. Implications for MCAM N-glycosylation.
24681327 2014 Monoclonal antibodies to human laminin ?4 chain globular domain inhibit tumor cell adhesion and migration on laminins 411 and 421, and binding of ?6?1 integrin and MCAM to ?4-laminins.
24612514 2014 Adhesion molecule CD146 and its soluble form correlate well with carotid atherosclerosis and plaque instability.
24473396 2014 Clinical value of circulating endothelial cells and of soluble CD146 levels in patients undergoing surgery for non-small cell lung cancer.
24335906 2013 Wnt5a uses CD146 as a receptor to regulate cell motility and convergent extension.
24204598 2013 CD146+ human umbilical cord perivascular cells maintain stemness under hypoxia and as a cell source for skeletal regeneration.
24188055 2014 CD146 expression on mesenchymal stem cells is associated with their vascular smooth muscle commitment.
24139427 2013 The relationship between early atherosclerosis and endothelial dysfunction in type 1 diabetic patients as evidenced by measurement of carotid intima-media thickness and soluble CD146 levels: a cross sectional study.
23878390 2013 MicroRNA 329 suppresses angiogenesis by targeting CD146.
23749325 2014 MCAM expression is associated with poor prognosis in non-small cell lung cancer.
23738744 2013 Relationship of CD146 expression to activation of circulating T cells: exploratory studies in healthy donors and patients with connective tissue diseases.
23712706 2013 Clinical significance of CD146 and latexin during different stages of thyroid cancer.
23670160 2013 miR-573 regulates melanoma progression by targeting the melanoma cell adhesion molecule.
23649916 2013 Endothelial cell adhesion molecule CD146: implications for its role in the pathogenesis of COPD.
23412095 2013 Perivascular support of human hematopoietic stem/progenitor cells.
23389031 2013 Soluble melanoma cell adhesion molecule (sMCAM/sCD146) promotes angiogenic effects on endothelial progenitor cells through angiomotin.
23333866 2013 Soluble CD146 in cerebrospinal fluid of active multiple sclerosis.
23266426 2013 CD146, a multi-functional molecule beyond adhesion.
23256918 2013 A novel function of MUC18: amplification of lung inflammation during bacterial infection.
23223580 2013 The involvement of CD146 and its novel ligand Galectin-1 in apoptotic regulation of endothelial cells.
23108590 2013 Identification of soluble CD146 as a regulator of trophoblast migration: potential role in placental vascular development.
22975388 2012 Melanoma cell adhesion molecule identifies encephalitogenic T lymphocytes and promotes their recruitment to the central nervous system.
22952755 2012 CD146 expression in human breast cancer cell lines induces phenotypic and functional changes observed in Epithelial to Mesenchymal Transition.
22826148 2012 CD146 gene expression in clear cell renal cell carcinoma: a potential marker for prediction of early recurrence after nephrectomy.
22801967 2013 Expression of the melanoma cell adhesion molecule in human mesenchymal stromal cells regulates proliferation, differentiation, and maintenance of hematopoietic stem and progenitor cells.
22754372 2012 CD146 expression correlates with epithelial-mesenchymal transition markers and a poor prognosis in gastric cancer.
22718841 2012 CD146 is a coreceptor for VEGFR-2 in tumor angiogenesis.
22635231 2012 Soluble CD146 and APS: a potential biomarker of obstetrical complications?
22610942 2012 MCAM is a novel metastasis marker and regulates spreading, apoptosis and invasion of ovarian cancer cells.
22399604 2012 The expression of CD146 predicts a poor overall survival in patients with adenocarcinoma of the lung.
22311021 2012 Soluble form of the endothelial adhesion molecule CD146 binds preferentially CD16+ monocytes.
22088599 2012 Clinical significance of plasma CD146 and P-selectin in patients with type 2 diabetic nephropathy.
22076922 2012 Identification of CD146 expression, angiogenesis, and lymphangiogenesis as progression, metastasis, and poor-prognosis related markers for gallbladder adenocarcinoma.
22057013 2012 METCAM/MUC18 augments migration, invasion, and tumorigenicity of human breast cancer SK-BR-3 cells.
22051146 2011 Increased expression of CD146 and microvessel density (MVD) in invasive micropapillary carcinoma of the breast: Comparative study with invasive ductal carcinoma-not otherwise specified.
21959269 2011 MCAM-expressing CD4(+) T cells in peripheral blood secrete IL-17A and are significantly elevated in inflammatory autoimmune diseases.
21804459 2011 The expression levels of stem cell markers importin13, c-kit, CD146, and telomerase are decreased in endometrial polyps.
21725352 2012 Recognition of CD146 as an ERM-binding protein offers novel mechanisms for melanoma cell migration.
21467165 2011 Expression of Id-1 is regulated by MCAM/MUC18: a missing link in melanoma progression.
21450088 2011 Up-regulation of METCAM/MUC18 promotes motility, invasion, and tumorigenesis of human breast cancer cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21415267 2011 CD146 expression on primary nonhematopoietic bone marrow stem cells is correlated with in situ localization.
21334670 2011 Enforced expression of METCAM/MUC18 increases tumorigenesis of human prostate cancer LNCaP cells in nude mice.
21269460 2011 Initial characterization of the human central proteome.
21239604 2011 Up-regulation of MUC18 in airway epithelial cells by IL-13: implications in bacterial adherence.
21095067 2011 Is CD146 pivotal in neoplasm invasion and blastocyst embedding?
20657552 2010 Immunocytochemistry of CD146 is useful to discriminate between malignant pleural mesothelioma and reactive mesothelium.
20589320 2010 mRNA levels of CD31, CD144, CD146 and von Willebrand factor do not serve as surrogate markers for circulating endothelial cells.
20448216 2010 CD146 short isoform increases the proangiogenic potential of endothelial progenitor cells in vitro and in vivo.
20354148 2010 Bone marrow-derived endothelial progenitor cells and endothelial cells may contribute to endothelial repair in the kidney immediately after ischemia-reperfusion.
20127798 2010 In vitro high-capacity assay to quantify the clonal heterogeneity in trilineage potential of mesenchymal stem cells reveals a complex hierarchy of lineage commitment.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20067117 2009 [Expression of adhension molecule CD146 in renal tubular epithelial cells and its clinical significance in IgA nephropathy].
19782948 2009 Endothelial CD146 is required for in vitro tumor-induced angiogenesis: the role of a disulfide bond in signaling and dimerization.
19703903 2009 Crosstalk between protease-activated receptor 1 and platelet-activating factor receptor regulates melanoma cell adhesion molecule (MCAM/MUC18) expression and melanoma metastasis.
19229070 2009 CD146 and its soluble form regulate monocyte transendothelial migration.
19221091 2009 Identification of MCAM/CD146 as the target antigen of a human monoclonal antibody that recognizes both epithelioid and sarcomatoid types of mesothelioma.
19200179 2009 Inhibition of CD146 gene expression via RNA interference reduces in vitro perineural invasion on ACC-M cell.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19123925 2009 CD146 expression is associated with a poor prognosis in human breast tumors and with enhanced motility in breast cancer cell lines.
19034879 High glucose effect on the role of CD146 in human proximal tubular epithelial cells in vitro.
19029148 2009 CD146(+) bone marrow osteoprogenitors increase in the advanced stages of primary myelofibrosis.
18922915 2008 A subset of host B lymphocytes controls melanoma metastasis through a melanoma cell adhesion molecule/MUC18-dependent interaction: evidence from mice and humans.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18604730 2008 CD146 protein in prostate cancer: revisited with two different antibodies.
18175063 2008 Serum adiponectin and markers of endothelial injury in hemodialysis patients with arteriosclerosis obliterans.
18160586 2008 Adipokines, linking adipocytes and vascular function in hemodialyzed patients, may also be possibly related to CD146, a novel adhesion molecule.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17982057 2007 Dual role of melanoma cell adhesion molecule (MCAM)/CD146 in lymphocyte endothelium interaction: MCAM/CD146 promotes rolling via microvilli induction in lymphocyte and is an endothelial adhesion receptor.
17872908 2007 Co-expression of two perivascular cell markers isolates mesenchymal stem-like cells from human endometrium.
17786470 2007 Expression and distribution of MUC18 in human uveal melanoma.
17545460 2007 Role of CD146 in detection of apoptotic circulating endothelial cells in obstructive sleep apnea.
17490776 2007 Elevation of serum adiponectin and CD146 levels in diabetic nephropathy.
17320204 2007 Visualization of CD146 dimerization and its regulation in living cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16969099 2006 The role of N-cadherin, MCAM and beta3 integrin in melanoma progression, proliferation, migration and invasion.
16835268 2006 Melanoma cell adhesion molecule is a novel marker for human fetal myogenic cells and affects myoblast fusion.
16804906 2006 M-CAM expression as marker of poor prognosis in epithelial ovarian cancer.
16570276 2006 The characterization of the invasion phenotype of uveal melanoma tumour cells shows the presence of MUC18 and HMG-1 metastasis markers and leads to the identification of DJ-1 as a potential serum biomarker.
16541130 2006 Knockdown of CD146 reduces the migration and proliferation of human endothelial cells.
16204154 2005 CD146 (Mel-CAM), an adhesion marker of endothelial cells, is a novel marker of lymphocyte subset activation in normal peripheral blood.
16098047 2005 Expression of gp130 in tumors and inflammatory disorders of the skin: formal proof of its identity as CD146 (MUC18, Mel-CAM).
15897668 Markers of endothelial cell activation/injury: CD146 and thrombomodulin are related to adiponectin in kidney allograft recipients.
15610525 2004 Endothelin-1 upregulates MCAM in melanocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597988 2003 Soluble CD146, a novel endothelial marker, is increased in physiopathological settings linked to endothelial junctional alteration.
14534536 2003 Reciprocal regulation of MelCAM and AKT in human melanoma.
12771231 2003 Melanoma cell adhesion molecule (MCAM/CD146) is expressed on human luteinizing granulosa cells: enhancement of its expression by hCG, interleukin-1 and tumour necrosis factor-alpha.
12496470 Cellular adhesion pathways and metastatic potential of human melanoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406332 2002 Selection of mimotopes of the cell surface adhesion molecule Mel-CAM from a random pVIII-28aa phage peptide library.
11848444 2002 Acute hyperglycaemia induces changes in the transcription levels of 4 major genes in human endothelial cells: macroarrays-based expression analysis.
11722842 2001 Isolation and characterization of the major form of human MUC18 cDNA gene and correlation of MUC18 over-expression in prostate cancer cell lines and tissues with malignant progression.
11709656 2001 Identification and functional assessment of endothelial P1H12.
11536311 2001 Expression of a human cell adhesion molecule, MUC18, in prostate cancer cell lines and tissues.
11329371 2001 HEMCAM/CD146 downregulates cell surface expression of beta1 integrins.
11036077 2001 Outside-in signaling pathway linked to CD146 engagement in human endothelial cells.
10756096 2000 Statistical analysis of the 5' untranslated region of human mRNA using "Oligo-Capped" cDNA libraries.
10726166 2000 Expression of CD146 adhesion molecules (MUC18 or MCAM) in the thymic microenvironment.
10702685 1999 Assignment of the human melanoma cell adhesion molecule gene (MCAM) to chromosome 11 band q23.3 by radiation hybrid mapping.
10687524 1999 Endothelial cell adhesion molecules in human dental pulp: a comparative immunohistochemical study on chronic periodontitis.
10451481 1999 The role of CD146 (Mel-CAM) in biology and pathology.
10211875 1999 Synovial fluid CD146 (MUC18), a marker for synovial membrane angiogenesis in rheumatoid arthritis.
9756930 1998 Activation of human endothelial cells via S-endo-1 antigen (CD146) stimulates the tyrosine phosphorylation of focal adhesion kinase p125(FAK).
9730695 Melanoma-associated adhesion molecule MUC18/MCAM (CD146) and transcriptional regulator mader in normal human CNS.
9462829 1998 CD146: biosynthesis and production of a soluble form in human cultured endothelial cells.
9036955 1997 MUC18/MCAM (CD146), an activation antigen of human T lymphocytes.
8573133 1996 Identification of the S-Endo 1 endothelial-associated antigen.
8378324 1993 Genomic organization of the melanoma-associated glycoprotein MUC18: implications for the evolution of the immunoglobulin domains.
8292890 1993 The progression associated antigen MUC18: a unique member of the immunoglobulin supergene family.
8162602 1994 Isolation and functional characterization of the A32 melanoma-associated antigen.
2602381 1989 MUC18, a marker of tumor progression in human melanoma, shows sequence similarity to the neural cell adhesion molecules of the immunoglobulin superfamily.