Property Summary

NCBI Gene PubMed Count 27
PubMed Score 71.06
PubTator Score 112.77

Knowledge Summary

Patent (15,856)

TINX Plot

  Disease (3)

Disease Target Count
Erythropoietic protoporphyria 15
Disease Target Count P-value
adult high grade glioma 2148 2.6e-03
Disease Target Count Z-score Confidence
Obesity 616 3.799 1.9

Gene RIF (16)

PMID Text
26223677 melanocortin receptors MC2R, MC3R and MC5R are most abundantly expressed in glandular epithelium of the endometrium
25860801 MC2R and MC1R signals are consecutively required for the regulation of EPO signal transduction in erythroblast differentiation, and MC5R signal transduction is required to induce enucleation.
23414113 D115 and D119 in TM3, F195 in TM5, and F254 in TM6 may form a binding pocket for NDP-alpha-MSH binding.
22871966 Melanocortin 5 receptor signaling and internalization: role of MAPK/ERK pathway and beta-arrestins 1/2.
21602033 Data suggest that antagonists of MC1R and MC5R could be effective inhibitors of sebaceous gland differentiation and the production of sebum-specific lipids.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19428994 MC5R signals through a PI3K-regulated Akt-independent pathway leading to downstream activation of ERK1/2
18551113 Observational study of gene-disease association. (HuGE Navigator)
17482720 Further structure-activity studies of lactam derivatives of MT-II and SHU-9119 were made at MC5R.
16314755 Observational study of gene-disease association. (HuGE Navigator)
16314755 Variations in the melanocortin 5 receptor gene are unlikely to confer susceptibility to bipolar disorder in this sample.
15470082 Outlining the ligand recognition sites in the melanocortin receptors.
11286624 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGAIVKNKNLHSP      1 - 70
MYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDSMICISVVASMCSLLAIAVDR     71 - 140
YVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILYSESTYVILCLISMFFAMLFLLVSLYIHMFL    141 - 210
LARTHVKRIAALPGASSARQRTSMQGAVTVTMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMY    211 - 280
LILIMCNSVMDPLIYAFRSQEMRKTFKEIICCRGFRIACSFPRRD                             281 - 325
//

Text Mined References (28)

PMID Year Title
26223677 2015 Expression of melanocortin receptors in human endometrium.
25860801 2015 Melanocortins contribute to sequential differentiation and enucleation of human erythroblasts via melanocortin receptors 1, 2 and 5.
23414113 2013 Molecular characterization of human melanocortin-5 receptor ligand-receptor interaction.
22871966 2012 Melanocortin 5 receptor signaling and internalization: role of MAPK/ERK pathway and ?-arrestins 1/2.
21602033 2011 A melanocortin receptor 1 and 5 antagonist inhibits sebaceous gland differentiation and the production of sebum-specific lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19502010 2009 Two complex genotypes relevant to the kynurenine pathway and melanotropin function show association with schizophrenia and bipolar disorder.
19428994 2009 Melanocortin 5 receptor activates ERK1/2 through a PI3K-regulated signaling mechanism.
19329486 2009 MRAP and MRAP2 are bidirectional regulators of the melanocortin receptor family.
18551113 2008 Further evidence for the role of ENPP1 in obesity: association with morbid obesity in Finns.
17482720 2007 Further structure-activity studies of lactam derivatives of MT-II and SHU-9119: their activity and selectivity at human melanocortin receptors 3, 4, and 5.
16314755 2005 Lack of association between variations in the melanocortin 5 receptor gene and bipolar disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470082 2005 Proteochemometric mapping of the interaction of organic compounds with melanocortin receptor subtypes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11606131 2001 Selective, high affinity peptide antagonists of alpha-melanotropin action at human melanocortin receptor 4: their synthesis and biological evaluation in vitro.
11286624 2001 Expression, candidate gene, and population studies of the melanocortin 5 receptor.
9892020 1999 Characterization of Agouti-related protein binding to melanocortin receptors.
9240466 1997 Glutamine235 and arginine272 in human melanocortin 5 receptor determines its low affinity to MSH.
9058374 1997 Effects of recombinant agouti-signaling protein on melanocortin action.
8932521 1996 Distribution of cDNA for melanocortin receptor subtypes in human tissues.
8396929 1993 Molecular cloning of a novel human melanocortin receptor.
8179577 1994 Molecular cloning and characterization of the rat fifth melanocortin receptor.
7956366 1995 Localization of the human melanocortin-5 receptor gene (MC5R) to chromosome band 18p11.2 by fluorescence in situ hybridization.
7739752 1995 Cloning, expression, and tissue distribution of a fifth melanocortin receptor subtype.