Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.02
PubTator Score 12.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -2.691 2.0e-05
posterior fossa group A ependymoma 2.100 8.1e-12
glioblastoma 1.700 3.1e-03
atypical teratoid / rhabdoid tumor 1.500 3.1e-02
medulloblastoma, large-cell 2.600 1.6e-06
primitive neuroectodermal tumor 1.500 3.6e-02
pancreatic ductal adenocarcinoma liver m... -2.214 4.8e-04
tuberculosis 2.200 1.5e-09
adult high grade glioma 2.100 3.0e-05
pilocytic astrocytoma 2.200 6.1e-07
sonic hedgehog group medulloblastoma 1.200 3.0e-03
subependymal giant cell astrocytoma 1.413 4.5e-02
Breast cancer -1.600 7.5e-04
ovarian cancer -3.100 7.3e-11
pituitary cancer 1.100 6.7e-04

Gene RIF (4)

PMID Text
19095965 MBNL3 was not found in human samples.
17102799 We exclude MBNL3 as the causative gene in this family.
15257297 MBNL proteins promote opposite splicing patterns for cardiac troponin T and insulin receptor alternative exons
12297108 results suggest that CHCR is an inhibitor of myogenesis

AA Sequence

MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL      1 - 70
HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM     71 - 140
GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD    141 - 210
NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGAT    211 - 280
PVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGN    281 - 350
QLKF                                                                      351 - 354
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19095965 2009 Muscleblind-like proteins: similarities and differences in normal and myotonic dystrophy muscle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17102799 2006 Fine mapping of the X-linked recessive congenital idiopathic nystagmus locus at Xq24-q26.3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15257297 2004 Muscleblind proteins regulate alternative splicing.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297108 2002 Inhibition of muscle differentiation by the novel muscleblind-related protein CHCR.
11929853 2002 Three proteins, MBNL, MBLL and MBXL, co-localize in vivo with nuclear foci of expanded-repeat transcripts in DM1 and DM2 cells.
10970838 2000 Recruitment of human muscleblind proteins to (CUG)(n) expansions associated with myotonic dystrophy.