Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 1.1e-03
astrocytic glioma -1.900 6.5e-03
atypical teratoid / rhabdoid tumor -1.600 7.3e-05
ependymoma -1.800 1.5e-02
gastric cancer 1.200 5.5e-03
glioblastoma -1.600 1.1e-05
oligodendroglioma -1.300 2.8e-02
ovarian cancer -1.300 2.5e-05

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKE      1 - 70
DAARRPLLAVATHVHFDHSGGLYQFDRVAVHHAEAEALARGDNFETVTWLSDSEVVRTPSPGWRARQFRV     71 - 140
QAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLIDWLPYSRISDYVG    141 - 210
TCERLIELVDRGLVEKVLPGHFNTFGAERLFRLASNYISKAGICHKVSTFAMRSLASLALRVTNSRTSP     211 - 279
//

Text Mined References (7)

PMID Year Title