Property Summary

NCBI Gene PubMed Count 61
PubMed Score 98.64
PubTator Score 77.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma 1.300 2.6e-03
dermatomyositis 1.100 6.3e-04
ependymoma 1.400 4.5e-03
esophageal adenocarcinoma 1.500 3.2e-02
glioblastoma 1.100 1.3e-02
group 4 medulloblastoma 1.300 2.2e-03
intraductal papillary-mucinous adenoma (... 2.000 6.9e-04
intraductal papillary-mucinous carcinoma... 1.200 4.3e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.0e-02
juvenile dermatomyositis 1.014 7.0e-09
malignant mesothelioma 1.100 2.0e-06
Multiple myeloma 1.386 1.4e-03
oligodendroglioma 1.100 6.7e-03
osteosarcoma 1.266 3.1e-04
ovarian cancer 2.400 2.1e-06
pancreatic ductal adenocarcinoma liver m... 1.406 4.9e-03
Pick disease 1.400 1.1e-04
primary Sjogren syndrome 1.200 4.0e-04
primitive neuroectodermal tumor 1.100 1.3e-03
psoriasis 1.600 1.3e-04
ulcerative colitis 1.100 6.0e-06
Waldenstrons macroglobulinemia 1.206 4.0e-03

PDB (14)

Gene RIF (46)

AA Sequence

MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSECNPLLQEPIA      1 - 70
SAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPED     71 - 140
FDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSKCKKDVFMPPSSSSELQESRGLSNFTST    141 - 210
HLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQ    211 - 280
KSQLDRTVCISDAGACGETLSVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYED    281 - 350
TFLESEEIGTKVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSS    351 - 420
KYNKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEV    421 - 490
ARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPED    491 - 560
HKLNKYHDWLWENHEKLSLS                                                      561 - 580
//

Text Mined References (65)

PMID Year Title